DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31370 and AgaP_AGAP013243

DIOPT Version :9

Sequence 1:NP_733095.2 Gene:CG31370 / 43060 FlyBaseID:FBgn0051370 Length:396 Species:Drosophila melanogaster
Sequence 2:XP_003435870.1 Gene:AgaP_AGAP013243 / 11175996 VectorBaseID:AGAP013243 Length:420 Species:Anopheles gambiae


Alignment Length:443 Identity:93/443 - (20%)
Similarity:166/443 - (37%) Gaps:131/443 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 LADQLNVPEWLNEQFVTDVL-----------RSHEKEPDLRVTKLDFTPGSAKGDNYASVIIRAR 59
            :...|||||     :|.|.|           ..|..:.|.||.:          :|.:.|.:..|
Mosquito     1 MKSSLNVPE-----YVRDALAGVAHRLGFTSNQHSVDYDFRVFE----------NNRSVVSVLYR 50

  Fly    60 VEYITQKGFFSKSLIIK--------TVLEMFAGSALFKTEIGMYRKVLPEFARILRENND----- 111
            |.:..:..  ..:::.|        |:|      |||:.|:.:|.|:||...:......|     
Mosquito    51 VTFREEPR--EATVLCKVPPPDADDTLL------ALFEREVFVYGKLLPALEQFQHTRQDGTAAT 107

  Fly   112 ---------TSRLYAECIYY----SLEPSQVMIFEDLGE-----------MDYAMVRDRVLTHGE 152
                     :|..:|...|:    :.:...::|.||:..           |||        .|..
Mosquito   108 PTTAADREESSVPFAPSCYHAHCDAKKGEGIIILEDVQRRGFSNRHKFEPMDY--------DHAR 164

  Fly   153 ICGAYSKLAKFHALSMKIINERPEFVKEFKDGICLVDIPYMSSGMG---------------PFKD 202
            :  |..:|.:|||.|:.:...:||..::::         ||....|               .|::
Mosquito   165 L--AMIQLGRFHATSLALKKHQPELFEQYR---------YMGDVTGERVLAMEGFEQTMEQAFEN 218

  Fly   203 FLGRIPELDRYKTH-FEKIEVHFIDRLRDIMKEYQTNPQPGYYVLCHGDYHTRNIMVKHNKESGG 266
            ....:|..|..:.. ..::...|.:.|::|.....:.|   :.|:|||||...|:|..:|   ||
Mosquito   219 AAATLPAGDAARREKLARLRGCFAEELQNISDTALSEP---FCVVCHGDYAGDNMMFSYN---GG 277

  Fly   267 FEDCM-LLDYQGCYVAPLAFDLMYSIYMLMNREQRIGELETLLNYYFSVLRETLRKIGYQGKLPD 330
            |...| :||:|.......|.|.::::::..:...|....:.:|..|.:.|...|.::|     .|
Mosquito   278 FPSRMVMLDWQLAKYGSPALDFVHTVFLSTDESFRRNHYDNMLQTYHNALLSHLERLG-----DD 337

  Fly   331 PPAFW------KEMYRLKDYEFLFLS-TYLPMSVGLSLETA-----TNEETDD 371
            ....|      ..:.:|:..:.|.|. .::|::|. |.|.|     ..||.:|
Mosquito   338 SATEWFPLTVLMRLIKLQARQALVLGLLHIPLTVA-SEEAAIAEGEPGEEDED 389

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31370NP_733095.2 EcKinase 47..324 CDD:281023 67/330 (20%)
APH <202..320 CDD:279908 28/119 (24%)
AgaP_AGAP013243XP_003435870.1 PKc_like 46..335 CDD:304357 65/321 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2AMXB
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.