DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31370 and AgaP_AGAP013201

DIOPT Version :9

Sequence 1:NP_733095.2 Gene:CG31370 / 43060 FlyBaseID:FBgn0051370 Length:396 Species:Drosophila melanogaster
Sequence 2:XP_003436598.1 Gene:AgaP_AGAP013201 / 11175923 VectorBaseID:AGAP013201 Length:408 Species:Anopheles gambiae


Alignment Length:424 Identity:107/424 - (25%)
Similarity:182/424 - (42%) Gaps:63/424 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 EWLNEQFVTDVLRSHEKEPDLRVTKLDFTPGSAKGDNYASVIIRARVEYITQKGFFSKSLIIKTV 78
            ||:|...:|.:|.........|:...|.:..:.|||||||.:.|..|:|  ..|...|..||..|
Mosquito     5 EWINNDLLTGLLSEQHGTSFKRLIAYDVSFATKKGDNYASEMYRVSVQY--DIGNIVKKRIILKV 67

  Fly    79 L-------EMFAGSALFKTEIGMYRKVLPEFARILRENNDTSRLYAECIYYSLEPSQVMIFEDLG 136
            :       ::...::::..||.:|.:::|....:||...|.|.:...|:..:..|.|:::|||:.
Mosquito    68 MPSGELQQKVMEENSIYSREIVIYSQIMPRIYELLRSIGDVSIISPLCLTTANTPKQMLVFEDVS 132

  Fly   137 EMDYAMVRDRV---LTHGEICGAYSKLAKFHALSMKIINERPEFVKEFKDGICLVDIPYMSSGMG 198
            |..:.|:..|:   |.|..:  ...||||.||.|..:....|.......:| |:.|.|...:.:.
Mosquito   133 EQSFKMMDRRLGLDLDHARL--VIVKLAKLHACSRIVYEAEPTLFDLMMEG-CISDDPKKQTFLP 194

  Fly   199 PFKDFLGRIPEL-------DRYKTHFEKIEVHFIDRLRDIMKEYQTN----PQPGYYVLCHGDYH 252
            .::..:|::..|       .|:.:...|     :|:|:|.:..|..:    ....:.||.|.|..
Mosquito   195 YYRRCVGQVMRLVQQWNKDGRWNSILGK-----LDKLQDKIIPYGCDVYHRRDDCFNVLNHNDIW 254

  Fly   253 TRNIMVKHNKESG-GFEDCMLLDYQGCYVAPLAFDLMYSIYMLMNREQRIGELETLLNYYFSVLR 316
            ..|:|.:.  |.| |.:|.:|||||..:......||.:.:|..:..|.|...|..|:..|.:.||
Mosquito   255 VNNMMFQF--EPGTGVKDVLLLDYQLSFYGSPGIDLNFLLYGSLQPEVRKLHLMELVQLYHTTLR 317

  Fly   317 ETLRKIGYQGKLPDPPAFWKEMYRLKDYEFLFLSTYLPMSVGLSLETATNEETDDKLQDFI---- 377
            .||.::.|.|.:|..|....|:.|...:....:...:|:        |..|.::|...|.|    
Mosquito   318 GTLEQLHYGGTIPSLPDIHVEIIRKGFHRVNAVFQQMPV--------AMMERSEDADMDLILGEG 374

  Fly   378 ---EECK--------------SILARFERSGYFE 394
               |.|:              ::|..|:.:|||:
Mosquito   375 ERSETCRRELFDNPRYVSILPALLHEFDLAGYFD 408

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31370NP_733095.2 EcKinase 47..324 CDD:281023 81/298 (27%)
APH <202..320 CDD:279908 34/129 (26%)
AgaP_AGAP013201XP_003436598.1 EcKinase 38..325 CDD:281023 81/298 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2AMXB
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25766
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.