DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31370 and AgaP_AGAP012971

DIOPT Version :9

Sequence 1:NP_733095.2 Gene:CG31370 / 43060 FlyBaseID:FBgn0051370 Length:396 Species:Drosophila melanogaster
Sequence 2:XP_003436595.1 Gene:AgaP_AGAP012971 / 11175866 VectorBaseID:AGAP012971 Length:858 Species:Anopheles gambiae


Alignment Length:400 Identity:111/400 - (27%)
Similarity:190/400 - (47%) Gaps:48/400 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 SLADQLNVPEWLNEQFVTDVLRSHEKEP--DLRVTKLDFTPGSAKGDNYASVIIRARVE---YIT 64
            |.:..::||||:.:::..|.:.....:|  |..:|.||....:..||||||::.|.||.   :.|
Mosquito     4 SASAAVSVPEWMTKEYFVDAIAVKLGKPATDFTITDLDVRRATEAGDNYASILYRVRVSVRLHNT 68

  Fly    65 QKGFFSKSLIIKTVL------EMFAGSALFKTEIGMYRKVLPEFARILRENNDTSRLYA-ECIYY 122
            .......|||:|.:.      ||.....||..||.||..|||...::..:...||..:. .|:.:
Mosquito    69 DGTPMDISLIVKALPKLSLTDEMVKLMNLFPKEIAMYTDVLPRLEQLYHQAGRTSVHFGPRCLKH 133

  Fly   123 SLEPSQVMIFEDLGEMDYAMVRDRV---LTHGEICGAYSKLAKFHALSMKIINERPEFVKEFKDG 184
            |.||:.|::.|||.|..:.|...|.   :.|..:  ...::|:|||.|:.:.:.|..:.:.|::|
Mosquito   134 STEPTDVIVLEDLRERQFTMANRRQGLDMEHTRL--VLRRMAQFHAASVVLEDHRGPYGELFREG 196

  Fly   185 ICLVDIPYMS----SGMGPFKDFLGRIPELDRYKT-HFEKIEVHF-IDRLRDIMKEYQTNPQPGY 243
            :.......||    .|..   ||..:|......|. |...:..|: :|....:::..:.| :.|:
Mosquito   197 MFTEKGRAMSEQFQKGQA---DFFQKIMRCWSEKAQHCASVMQHWGMDLFDSLIRVTRAN-RKGF 257

  Fly   244 YVLCHGDYHTRNIMVKHNKESGGFEDCMLLDYQGCYVAPLAFDLMYSIYMLMNREQRIGELETLL 308
            .||.|||....||:.::|::| ...|.:|:|||..:.|..|.||:|.::..:|.:.::.::..|:
Mosquito   258 NVLNHGDMWCNNILFQYNEDS-TVNDILLIDYQLSFWASPAIDLIYFMFTSVNGDFKLSQMNYLV 321

  Fly   309 NYYFSVLRETLRKIGYQGKLPDPPAFWKEM------YRLKDYEFLFLSTYLPMSVGLSLETATNE 367
            .||...|.::|:.:||.|.:|    ..||:      :.|..|...|  :.||:.:        .|
Mosquito   322 QYYHEHLVDSLKFLGYTGTVP----LLKELHSDIISHHLFGYMICF--SILPICL--------ME 372

  Fly   368 ETDDKLQDFI 377
            :|||...|.:
Mosquito   373 KTDDASMDLM 382

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31370NP_733095.2 EcKinase 47..324 CDD:281023 84/295 (28%)
APH <202..320 CDD:279908 33/119 (28%)
AgaP_AGAP012971XP_003436595.1 EcKinase 49..337 CDD:281023 84/294 (29%)
EcKinase 478..765 CDD:281023
Adenylation_DNA_ligase_like <776..811 CDD:299865
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2AMXB
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.