DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31370 and AgaP_AGAP013194

DIOPT Version :9

Sequence 1:NP_733095.2 Gene:CG31370 / 43060 FlyBaseID:FBgn0051370 Length:396 Species:Drosophila melanogaster
Sequence 2:XP_003436597.1 Gene:AgaP_AGAP013194 / 11175655 VectorBaseID:AGAP013194 Length:404 Species:Anopheles gambiae


Alignment Length:405 Identity:102/405 - (25%)
Similarity:154/405 - (38%) Gaps:96/405 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 WLNEQFVTDVL---RSHEKEPDLRVTKLDFTPGSAKGDNYASVIIRARVEYITQKGF---FSKSL 73
            |...:|..|.:   .|.|......:|..:....:.|...|.|.|.|..:|....||.   .|.|.
Mosquito     6 WKTAEFFKDAIVRDLSLECTDSFTITSFEVGKANEKTAGYMSNIYRVLIELKFDKGTAKPTSLSY 70

  Fly    74 IIKTVLEMFAGSAL------FKTEIGMYRKVLPEFARILRENNDTSRLYAECIYYSLEPSQVMIF 132
            |:|...:...||.|      |..|..:|.|:||.|.|:::...:|.|...:.:..:..|..|::.
Mosquito    71 IVKEKTDTAFGSGLVELLSVFPKESEVYEKLLPAFERLVQNEEETVRFGPKVLKTTTNPDTVIVL 135

  Fly   133 EDLGEMDYAMVRDRV--LTHGEICGAYSKLAKFHALSMKIINERPEFVKEFKDGICLVDIPYMSS 195
            |||....:.| |::.  |:..::.....|||||||.|:..:.:...|...|.:|:          
Mosquito   136 EDLSRSQFRM-REKSFGLSVTDVKRILEKLAKFHAASVLYVEKNGAFSDLFAEGV---------- 189

  Fly   196 GMGPFKDFLGRIPE--LDRYKTHFEKIEVHFIDRLRDIMKEYQTNPQPGYY-------------- 244
                       |.|  :|..:.|:|.:...|:..|||      .|..|.|.              
Mosquito   190 -----------ISERTIDALRGHYESLYSAFVQSLRD------RNMAPEYLQPLIKFDGQLLREC 237

  Fly   245 ------------VLCHGDYHTRNIMVKHNKESGGFEDCMLLDYQ-GCYVAPLAFDLMYSIYMLMN 296
                        ||.|||....|:|.       |.||...||:| ..|.:|.| ||:| .:....
Mosquito   238 CKAQQVHHSELKVLNHGDLWPNNVMF-------GTEDLRFLDFQTASYGSPAA-DLLY-FFATSA 293

  Fly   297 REQRIGELETLLNYYFSVLRETLRKIGYQGKLPDPPAFWKEMY-----RLKDYEFLFLSTYLPMS 356
            .|.....||.||.||...|.:||:::.|...:|        ||     :::....|.|.   |:|
Mosquito   294 TELMCDSLEELLQYYHEHLVKTLQQLQYCKSIP--------MYTELLDQMRRRSVLLLP---PLS 347

  Fly   357 VGLSLETATNEETDD 371
            ..|::..:...|..|
Mosquito   348 EALAITMSGLTEPSD 362

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31370NP_733095.2 EcKinase 47..324 CDD:281023 85/316 (27%)
APH <202..320 CDD:279908 40/146 (27%)
AgaP_AGAP013194XP_003436597.1 PKc_like 44..321 CDD:304357 84/313 (27%)
APH <208..310 CDD:279908 33/116 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2AMXB
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25766
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.