DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31097 and CG31370

DIOPT Version :9

Sequence 1:NP_733093.2 Gene:CG31097 / 43058 FlyBaseID:FBgn0051097 Length:420 Species:Drosophila melanogaster
Sequence 2:NP_733095.2 Gene:CG31370 / 43060 FlyBaseID:FBgn0051370 Length:396 Species:Drosophila melanogaster


Alignment Length:381 Identity:102/381 - (26%)
Similarity:171/381 - (44%) Gaps:59/381 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 ESLVVPKWLNKSKFESLIA--KDEPDF--TKIDQFTTVAAVPPGGNFASVMLRVYLDIVMKDGSQ 68
            :.|.||:|||:.....::.  :.|||.  ||:| ||..:|  .|.|:|||::|..::.:.:.|..
  Fly     8 DQLNVPEWLNEQFVTDVLRSHEKEPDLRVTKLD-FTPGSA--KGDNYASVIIRARVEYITQKGFF 69

  Fly    69 KRKSYVVKTMLESDKGGKAVNEMRYFHKEQQMYSTYLPQFEKIYRVAGHPVQLMPKCLEIGEIDG 133
            . ||.::||:||...|.      ..|..|..||...||:|.:|.|......:|..:|:.. .::.
  Fly    70 S-KSLIIKTVLEMFAGS------ALFKTEIGMYRKVLPEFARILRENNDTSRLYAECIYY-SLEP 126

  Fly   134 NIYFIFEDLSTRNF-VAADRTKGVNMEHMRL--SLRKLAELHAASV-IYKERYGPYHADFDNGFA 194
            :...|||||...:: :..||.    :.|..:  :..|||:.||.|: |..|| ..:..:|.:|..
  Fly   127 SQVMIFEDLGEMDYAMVRDRV----LTHGEICGAYSKLAKFHALSMKIINER-PEFVKEFKDGIC 186

  Fly   195 RKDKIEHSVRRFEVKAPEYKAAMKTWGIDECYLKNFPTTEQYGKLCLESLNV------------- 246
            ..|            .|...:.|   |..:.:|...|..::| |...|.:.|             
  Fly   187 LVD------------IPYMSSGM---GPFKDFLGRIPELDRY-KTHFEKIEVHFIDRLRDIMKEY 235

  Fly   247 --DPQ-DFNVLTHGDFSPSNILFKYN-ENGAPSEALILDFQICKWASPTQDLLMLIILSARKDSS 307
              :|| .:.||.|||:...||:.|:| |:|...:.::||:|.|..|....||:..|.:...::..
  Fly   236 QTNPQPGYYVLCHGDYHTRNIMVKHNKESGGFEDCMLLDYQGCYVAPLAFDLMYSIYMLMNREQR 300

  Fly   308 YKEFDNIVRIYWEYLIDFLRVLKYKKPLPQLRELQSAIYKKNNTFSAFFAVMNHLP 363
            ..|.:.::..|:..|.:.||.:.|:..||........:|:..:  ..|..:..:||
  Fly   301 IGELETLLNYYFSVLRETLRKIGYQGKLPDPPAFWKEMYRLKD--YEFLFLSTYLP 354

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31097NP_733093.2 EcKinase 46..331 CDD:281023 80/305 (26%)
CG31370NP_733095.2 EcKinase 47..324 CDD:281023 80/305 (26%)
APH <202..320 CDD:279908 30/118 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45459739
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2AMXB
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25766
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11012
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.940

Return to query results.
Submit another query.