DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31097 and E02C12.12

DIOPT Version :10

Sequence 1:NP_733093.2 Gene:CG31097 / 43058 FlyBaseID:FBgn0051097 Length:420 Species:Drosophila melanogaster
Sequence 2:NP_505432.2 Gene:E02C12.12 / 183991 WormBaseID:WBGene00017097 Length:200 Species:Caenorhabditis elegans


Alignment Length:105 Identity:21/105 - (20%)
Similarity:46/105 - (43%) Gaps:18/105 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 FESLIAKDEPDFTKIDQFTTVA---AVPPGGNFASVMLRVYLDIVMKDGSQKRKSYVVKTMLESD 82
            |:|:||..|||:..:::...:.   ||......|..:|...:.:..::|..:.|         .:
 Worm    26 FQSIIALIEPDWIDVEKGKDLPKKFAVKISTQLALAVLSKIMKLGGENGFSEEK---------LN 81

  Fly    83 KGGKAV-----NEMRYFHKEQQMYSTYLPQFEKIYRVAGH 117
            :.||.:     .|:..:...::|....:| :.|:|.:.|:
 Worm    82 ELGKLIRDGHNREVATYKLLEKMNHPDIP-YTKVYGLKGY 120

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31097NP_733093.2 EcKL 46..331 CDD:397213 12/77 (16%)
E02C12.12NP_505432.2 Protein Kinases, catalytic domain 1..>200 CDD:473864 21/105 (20%)

Return to query results.
Submit another query.