DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31098 and CG18765

DIOPT Version :9

Sequence 1:NP_733091.1 Gene:CG31098 / 43057 FlyBaseID:FBgn0051098 Length:417 Species:Drosophila melanogaster
Sequence 2:NP_001097750.1 Gene:CG18765 / 59149 FlyBaseID:FBgn0042110 Length:393 Species:Drosophila melanogaster


Alignment Length:451 Identity:89/451 - (19%)
Similarity:155/451 - (34%) Gaps:107/451 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 SKNYQAPEWLTAEFLQDVLKE--HFK---------EEQLAVTELIVK-SAQVGDQAAGFASEMHR 57
            |::...|.|:..:.|:.::|:  .|:         |.|||...|.|. ...|.|.          
  Fly    11 SQDASLPTWVEKKELEALVKQISEFRKIESLRWKWETQLAEPALCVHIQVLVADN---------- 65

  Fly    58 ASFNLQRGTAPKGKFSVIVKDHPKGQTGAVAHRSKLFKREILAYKEVLPRIQALLQSIGDQTKIA 122
                      .|.:.|.::|.......|....|:..|..|...::.|||.::.|.|:........
  Fly    66 ----------KKRQVSYLIKSPETVPVGLKLPRTGDFSTERHMFEVVLPALEELYQNSDRIVHFG 120

  Fly   123 PTCYYTTESPEPFLILEDMQLSGFENFERG-------RLLNLDYVLPTIEKVAKLHACSALIAQD 180
            |        |.....|:...:.|.....:|       :.|::..:...:.|:|..||.:|.....
  Fly   121 P--------PVIQAKLKSSHIYGDYILNKGYSVANGLKGLSVTAMEGVLSKLAAYHAGTAAYIAK 177

  Fly   181 SPEVLEFFDEAPISRNPDRRDFLTFFPVNIRCVAEEVAHWKGYEEITEKMFNLAENVLQRALTMF 245
            :|..:.   |.|..|...:.|             ||.|..|...::     ...|::.......:
  Fly   178 TPGKIR---ELPKLRENSKSD-------------EETAELKSLYQL-----RFHESLRSNDARQY 221

  Fly   246 ESTGKDFR--------------VFNLT---DLWINNLLFHIN--NETKEPDDVVTLDFQLAYVGS 291
            |...|.|:              .||:.   ..|.||||..::  ...|   |.:...|..|..|.
  Fly   222 EDKVKSFQKYVKSGTEILDSKTSFNVILNGSCWPNNLLLQVDAFGNVK---DTLFSGFHTAQYGP 283

  Fly   292 PTIDLNYFLYGSLNENVRKVHYKYIVREYQRVLQQTLEKLNYQGHIPTLKEIHIELIKTSLMGVI 356
            ...||...|..:..|  :...:...|:.|...|.:.|..|.:.|..|:|.::.::|:|.......
  Fly   284 AVYDLFSSLLTAPAE--KSSRFDGYVKFYHDQLIENLNLLKFLGKKPSLTDLQLDLLKYGHWAFE 346

  Fly   357 GATCLTPLIFREGAGFENLEDLNSRTESGDRFRRENVENPKYRAFLQRTIKEFELSGFLDE 417
            .||.:.|::..: .|..::|:|         ||     ||.:...::..:...|..|:.:|
  Fly   347 TATEILPIVLSD-FGNNDIEEL---------FR-----NPVFGEQIRELLPWMENRGYFEE 392

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31098NP_733091.1 EcKinase 50..333 CDD:281023 57/308 (19%)
CG18765NP_001097750.1 PKc_like 56..323 CDD:304357 60/320 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2AMXB
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D343262at33208
OrthoFinder 1 1.000 - - FOG0000277
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11012
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.920

Return to query results.
Submit another query.