DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31098 and CG31370

DIOPT Version :9

Sequence 1:NP_733091.1 Gene:CG31098 / 43057 FlyBaseID:FBgn0051098 Length:417 Species:Drosophila melanogaster
Sequence 2:NP_733095.2 Gene:CG31370 / 43060 FlyBaseID:FBgn0051370 Length:396 Species:Drosophila melanogaster


Alignment Length:431 Identity:114/431 - (26%)
Similarity:180/431 - (41%) Gaps:74/431 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 PEWLTAEFLQDVLKEHFKEEQLAVTEL-IVKSAQVGDQAAGFASEMHRA--SFNLQRGTAPKGKF 72
            ||||..:|:.|||:.|.||..|.||:| ....:..||   .:||.:.||  .:..|:|...|   
  Fly    13 PEWLNEQFVTDVLRSHEKEPDLRVTKLDFTPGSAKGD---NYASVIIRARVEYITQKGFFSK--- 71

  Fly    73 SVIVKDHPKGQTGAVAHRSKLFKREILAYKEVLPRIQALLQSIGDQTKIAPTCYYTTESPEPFLI 137
            |:|:|...:...|     |.|||.||..|::|||....:|:...|.:::...|.|.:..|...:|
  Fly    72 SLIIKTVLEMFAG-----SALFKTEIGMYRKVLPEFARILRENNDTSRLYAECIYYSLEPSQVMI 131

  Fly   138 LEDMQLSGFENFERGRLLNLDYVLPTIEKVAKLHACSALIAQDSPE-VLEFFDEAPISRNP---- 197
            .||:....:. ..|.|:|....:.....|:||.||.|..|..:.|| |.||.|...:...|    
  Fly   132 FEDLGEMDYA-MVRDRVLTHGEICGAYSKLAKFHALSMKIINERPEFVKEFKDGICLVDIPYMSS 195

  Fly   198 ---DRRDFLTFFPVNIRCVAEEVAHWK-GYEEITEKMFNLAENVLQRALTMFESTGKDFRVFNLT 258
               ..:|||...|        |:..:| .:|:|.....:...::::...|   :....:.|....
  Fly   196 GMGPFKDFLGRIP--------ELDRYKTHFEKIEVHFIDRLRDIMKEYQT---NPQPGYYVLCHG 249

  Fly   259 DLWINNLLFHINNETKEPDDVVTLDFQLAYVGSPTIDLNYFLYGSLNENVRKVHYKYIVREYQRV 323
            |....|::...|.|:...:|.:.||:|..||.....||.|.:|..:|...|....:.::..|..|
  Fly   250 DYHTRNIMVKHNKESGGFEDCMLLDYQGCYVAPLAFDLMYSIYMLMNREQRIGELETLLNYYFSV 314

  Fly   324 LQQTLEKLNYQGHIP----------TLKEIHIELIKTSLMGVIGATCLTPLIFREGAGFENLEDL 378
            |::||.|:.|||.:|          .||:.....:.|.|...:|.:.       |.|..|..:| 
  Fly   315 LRETLRKIGYQGKLPDPPAFWKEMYRLKDYEFLFLSTYLPMSVGLSL-------ETATNEETDD- 371

  Fly   379 NSRTESGDRFRRENVENPKYRAFLQR---TIKEFELSGFLD 416
                              |.:.|::.   .:..||.||:.:
  Fly   372 ------------------KLQDFIEECKSILARFERSGYFE 394

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31098NP_733091.1 EcKinase 50..333 CDD:281023 78/293 (27%)
CG31370NP_733095.2 EcKinase 47..324 CDD:281023 80/299 (27%)
APH <202..320 CDD:279908 30/128 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2AMXB
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25766
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11012
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.