DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11893 and pkdc

DIOPT Version :9

Sequence 1:NP_651375.1 Gene:CG11893 / 43056 FlyBaseID:FBgn0039316 Length:416 Species:Drosophila melanogaster
Sequence 2:XP_001335286.1 Gene:pkdc / 797003 ZFINID:ZDB-GENE-041111-115 Length:322 Species:Danio rerio


Alignment Length:233 Identity:52/233 - (22%)
Similarity:90/233 - (38%) Gaps:48/233 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   135 SLEPRQVLIFEDLVPQGYFVIRDRPINMNEYKNVFSKLAKWHAVSMKVLNEQPDILKDFKYGLME 199
            |....|:::.|||...| |.:|...:|..|.|...|.:|.:||:.:.|..|          ||..
Zfish   103 SFGEEQLIVLEDLDVAG-FPVRKTYVNDAEIKACLSWIANFHALFLDVTPE----------GLWP 156

  Fly   200 MPSIMSDPMVTTGMDNFLKMMDQIPELTKYKPHFEKIKENYIQRMGDVMQEYRKNVQSDGYYVMC 264
            :.:...              ::..||      ..|.:.:..::.....:.....|.:   :..:.
Zfish   157 IGTYWH--------------LETRPE------ELEAMSDQKLKAAAGEIDSILNNCR---FKTIV 198

  Fly   265 HGDFHGRNMMFNKNE-EVMFVDFQI----CNLCPITIDLSYSVYMLMEPEQRWDLGKDLINFYFS 324
            |||....|..|:|:. :|..||||.    |.:    .|:.|.:...|:..:.......|:::|||
Zfish   199 HGDAKLANFCFSKDGLQVASVDFQYVGGGCGM----KDVIYFLGSCMDERECEKKAPGLLDYYFS 259

  Fly   325 VLEDTLKKVGYKGKMPTNDGLWKQIHRHKFYDF--FLL 360
            .|..:|:|   |......:..|:.:....:.||  |||
Zfish   260 ELRKSLEK---KVDFAELEKEWRNMFAFAWTDFHRFLL 294

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11893NP_651375.1 EcKinase 52..335 CDD:281023 45/204 (22%)
pkdcXP_001335286.1 PKc_like <96..267 CDD:304357 44/201 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170589382
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.