DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11893 and CG18765

DIOPT Version :9

Sequence 1:NP_651375.1 Gene:CG11893 / 43056 FlyBaseID:FBgn0039316 Length:416 Species:Drosophila melanogaster
Sequence 2:NP_001097750.1 Gene:CG18765 / 59149 FlyBaseID:FBgn0042110 Length:393 Species:Drosophila melanogaster


Alignment Length:333 Identity:70/333 - (21%)
Similarity:139/333 - (41%) Gaps:49/333 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   100 FSTEINAYTKALPEFERILREAGDDTKLFVPCIYHSLEPRQVLIFED-LVPQGYFVIRD-RPINM 162
            ||||.:.:...||..|.:.:.:........|.|...|:...  |:.| ::.:||.|... :.:::
  Fly    92 FSTERHMFEVVLPALEELYQNSDRIVHFGPPVIQAKLKSSH--IYGDYILNKGYSVANGLKGLSV 154

  Fly   163 NEYKNVFSKLAKWHAVSMKVLNEQPDILKDFKYGLMEMPSIMSDPMVTTGMDNFLKMMDQIPEL- 226
            ...:.|.||||.:||.:...:.:.|..::       |:|.:..:.          |..::..|| 
  Fly   155 TAMEGVLSKLAAYHAGTAAYIAKTPGKIR-------ELPKLRENS----------KSDEETAELK 202

  Fly   227 TKYKPHF-EKIKENYIQRMGDVMQEYRKNVQS--------DGYYVMCHGDFHGRNMM-----FNK 277
            :.|:..| |.::.|..::..|.::.::|.|:|        ..:.|:.:|.....|::     |..
  Fly   203 SLYQLRFHESLRSNDARQYEDKVKSFQKYVKSGTEILDSKTSFNVILNGSCWPNNLLLQVDAFGN 267

  Fly   278 NEEVMFVDFQICNLCPITIDLSYSVYMLMEPEQRWDLGKDLINFYFSVLEDTLKKVGYKGKMPTN 342
            .::.:|..|......|...||..|  :|..|.::.......:.||...|.:.|..:.:.||.|:.
  Fly   268 VKDTLFSGFHTAQYGPAVYDLFSS--LLTAPAEKSSRFDGYVKFYHDQLIENLNLLKFLGKKPSL 330

  Fly   343 DGLWKQIHRHKFYDFFLLTTFSPMIVAVKANTFKIHELIQDPEIRQKSYLYDPYVQDVKKLLGKY 407
            ..|...:.::..:.|...|...|::::...|. .|.||.::|          .:.:.:::||...
  Fly   331 TDLQLDLLKYGHWAFETATEILPIVLSDFGNN-DIEELFRNP----------VFGEQIRELLPWM 384

  Fly   408 EEMGYFND 415
            |..|||.:
  Fly   385 ENRGYFEE 392

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11893NP_651375.1 EcKinase 52..335 CDD:281023 52/251 (21%)
CG18765NP_001097750.1 PKc_like 56..323 CDD:304357 52/251 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45459833
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2AMXB
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11012
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.