DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11893 and CHKov2

DIOPT Version :9

Sequence 1:NP_651375.1 Gene:CG11893 / 43056 FlyBaseID:FBgn0039316 Length:416 Species:Drosophila melanogaster
Sequence 2:NP_651387.1 Gene:CHKov2 / 43068 FlyBaseID:FBgn0039328 Length:409 Species:Drosophila melanogaster


Alignment Length:429 Identity:103/429 - (24%)
Similarity:174/429 - (40%) Gaps:62/429 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 PAWLNAQFITDVL----RTYEKCPELEVTDLKITPASA--QGDHYASVMFRTTAEYTTSKGKF-- 74
            |.|:..:..:.:|    |.::..       :|..|.||  :|::|.:::.|...|........  
  Fly     7 PQWVTKELFSSLLEQSNRNFKAI-------IKFVPTSAISKGENYLTIVLRIQIEMQLKDNSIED 64

  Fly    75 -CKPLIIKTMPEQEGHKKDMLSDSHLFSTEINAYTKALPEFERILREAGDDTKLFVPCIYHSLEP 138
             ...|.|..:||.|  |.|.   ..:|..|::.|...:||.|.:..:....:..|.|  .|...|
  Fly    65 VSYILKIPLVPEDE--KNDF---HEMFDAELDMYDHLIPELEDLYAKNTSISPKFKP--VHLKFP 122

  Fly   139 RQ-----VLIFEDLVPQGY-FVIRDRPINMNEYKNVFSKLAKWHAVSMKVLNEQPDILKDFK--Y 195
            .:     .::.|||..:|| ...|.:.:...|.:.|..|||:|||.|.|.:.|..:..||.:  |
  Fly   123 GEPVKSDYILLEDLRKKGYRNADRTQGLEQFEVEAVLKKLAQWHAASAKRVVELGEYEKDIRESY 187

  Fly   196 GLMEMPSIMSDPMVTTGMDNFLKMMDQIPELTKYKPHFEKIKENYIQRMGDVMQEYRKNVQSDGY 260
            ...|...::.:..:...|. ||:.|.|.    ..:|....:..:|..::.|:..|:.||...: .
  Fly   188 FTTEHQKLLDEFNINFCMP-FLECMQQY----NLEPGQLVLISDYTSQLTDLNIEFGKNDPLE-L 246

  Fly   261 YVMCHGDFHGRNMMFN-KN----EEVMFVDFQICN--------LCPITIDLSYSVYMLMEPEQRW 312
            .|:.||||...|.||. ||    |:|.|||||:..        ||.:.....:|:.:     .::
  Fly   247 SVLNHGDFWCNNFMFKYKNASEVEDVCFVDFQLPKYGTPAQDLLCILMTSPKFSIKL-----DKF 306

  Fly   313 DLGKDLINFYFSVLEDTLKKVGYKGKMPTNDGLWKQIHRHKFYDFFLLTTFSPMIVAVKANTFKI 377
            |.   .|.:|...|.:.|..:.|....||.......:||:..:.|.......|:::........|
  Fly   307 DY---FIEYYHQQLVEHLTMLNYNRNAPTLSKFHAHLHRYSLWAFICAQRMLPIVLLPPDVDSHI 368

  Fly   378 HELIQDPE----IRQKSYLYDPYVQDVKKLLGKYEEMGY 412
            ..::.:.|    .::|.:|...||..:|.:|......||
  Fly   369 GNVMGNSEEAIAFKRKMFLLPAYVDQIKVILPWLINRGY 407

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11893NP_651375.1 EcKinase 52..335 CDD:281023 78/306 (25%)
CHKov2NP_651387.1 EcKinase 40..326 CDD:281023 78/306 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45459826
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25766
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11012
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.950

Return to query results.
Submit another query.