DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11893 and CG14314

DIOPT Version :9

Sequence 1:NP_651375.1 Gene:CG11893 / 43056 FlyBaseID:FBgn0039316 Length:416 Species:Drosophila melanogaster
Sequence 2:NP_650690.1 Gene:CG14314 / 42179 FlyBaseID:FBgn0038581 Length:438 Species:Drosophila melanogaster


Alignment Length:375 Identity:83/375 - (22%)
Similarity:163/375 - (43%) Gaps:84/375 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 ADELEAPAWLNAQFITDVLRTYEKCPELEVTDLKITPASAQGDHYASVMFRTTAEYTTSKGKFCK 76
            |:.:|:...|:.:...|:.:..|  |::::...::...|.:||:|.:.::|..........|:.:
  Fly    17 ANAVESKQILSLEVFQDIFKHVE--PDVQIDAFELAQGSDRGDNYTAALYRIKLTGKRRSLKWEQ 79

  Fly    77 PLIIKTMPE----QEGHKKDMLSDSHLFSTEINAYTKALPEFERI-LREAGDDTKLF--VPCIY- 133
            .:|.|.|||    :|.:|.|     .||..|:..|...:||..:. ..:...||.:|  :|..| 
  Fly    80 NVICKVMPESVVAREAYKSD-----KLFRNEVQFYNTIMPELLKFQASKTNQDTPVFNAIPKCYS 139

  Fly   134 --HSLEPRQVLIFEDLVPQGYFVI-RDRPINMNEYKNVFSKLAKWHAVSMKVLNEQPDILKDFKY 195
              |.|     ||.|||..:|:.:. |.:.:::.|.::|..::|:.|.:|:....|:|   .:|. 
  Fly   140 ARHDL-----LIMEDLRERGFQMSDRHKGLSLEETQSVLLQVAQLHGLSLAYKFEKP---LEFS- 195

  Fly   196 GLMEMPSIMSDPMVTTGMDNFLKMMDQIPELTKYKPHFEKIKENYIQRMGDVMQEYRKNV----- 255
               .:.|::|:.:..|...::            |:.::|::.:|.||.:.:|:....|.|     
  Fly   196 ---NLCSMISEGIFCTANTSW------------YRNYYERLTKNAIQMVSEVLPPDSKYVLAMNK 245

  Fly   256 --QSDGYY--------------VMCHGDFHGRNMMFNKNE-------EVMFVDFQICNLCPITID 297
              :|..::              .:||||....|.:::.:.       ||..:|||:.....|.:|
  Fly   246 FAESSSFFGRMVKLASTESPLSAICHGDCWVNNFLYHYDPEDPHRVLEVALLDFQLIRYSSIALD 310

  Fly   298 LSYSVYMLMEPEQRWDLGKDLINFY----FSVLE----------DTLKKV 333
            ::..:|.....|.|....:.|:..|    |..|:          |||:|:
  Fly   311 IANLLYCCTTKEMRDAQLQTLLKIYTEELFRWLQMLCTNLPDHCDTLQKL 360

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11893NP_651375.1 EcKinase 52..335 CDD:281023 76/335 (23%)
CG14314NP_650690.1 EcKinase 56..346 CDD:281023 72/318 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2AMXB
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11012
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.