DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11893 and CG6830

DIOPT Version :9

Sequence 1:NP_651375.1 Gene:CG11893 / 43056 FlyBaseID:FBgn0039316 Length:416 Species:Drosophila melanogaster
Sequence 2:NP_650103.1 Gene:CG6830 / 41408 FlyBaseID:FBgn0037934 Length:891 Species:Drosophila melanogaster


Alignment Length:428 Identity:100/428 - (23%)
Similarity:184/428 - (42%) Gaps:69/428 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 PENADTEQFNADELEAPAWLNAQFITDVLRT----YEKCPELEVTDLKITPASAQGDHYASVMFR 62
            |.|....:.:..:| .|.|||.....::|..    :.|     :...::.||.|.|::||::|.|
  Fly    32 PPNKPEPEVDHSDL-VPKWLNQTQFEELLAADVDQFSK-----IVGFRVKPAMAPGENYATLMLR 90

  Fly    63 TT--AEYTTSKGKFCKPLIIKTMPEQEGHKKDMLSDSHLFSTEINAYTKALPEFERILREAGDDT 125
            .:  .|.|....|...  .:..:|......:.|:|.::.|::|..|||:.||:.|.:.:..|.|.
  Fly    91 ISIDVELTDKSTKLVS--FMMKVPHDTPQMEQMMSMANFFTSENAAYTEILPKMEELYKAKGLDI 153

  Fly   126 KLFVPCIYH---SLEPR--QVLIFEDLVPQGYFVI-RDRPINMNEYKNVFSKLAKWHAVS---MK 181
            | |.|..:.   :.||:  ..::..||...|:..| |...:|:.:.|...::||::||..   ::
  Fly   154 K-FAPRAFKLDATKEPKVANTVLMHDLGQNGFKNINRLECLNLEQTKFALTRLAQFHAAGATMVQ 217

  Fly   182 VLNEQPDILKDFKYGLM----EMPSIMSDPMVTTGMDNFLKMMDQIPELTKYKPHFEKIKENYIQ 242
            |....|||   |..|:|    |......:.|:.:...:|:..:|:.....:|:...||       
  Fly   218 VHGPYPDI---FVNGVMGNNKEAIIAFMEGMLASFRTSFMANLDKFKNGEEYREKLEK------- 272

  Fly   243 RMGDVMQEYRK--NVQSDGYYVMCHGDFHGRNMMFNKN-----EEVMFVDFQICNLCPITIDLSY 300
            .:..:..|:.|  .|..:.:..:.|||....|::|..|     |:::|||||........:||.|
  Fly   273 ALAGLTMEFMKLGIVDPNEFNALNHGDCWMNNLLFKMNSSGDLEDMVFVDFQNPKYGSPAMDLLY 337

  Fly   301 SVYMLMEPEQRWDLGKDLINFYFSVLEDTLKKVGYKGKMPTNDGLWKQIHRH--KFYDFFLLTTF 363
            .:...::.:.:.......|..|...|...|..:|:.|:.|:    .:::||.  |:..:.|..|.
  Fly   338 FIISSVQIDYKLSHFDFFIRHYQEALVKHLGILGFTGRKPS----LRELHRTLIKYGGWVLFPTI 398

  Fly   364 S--PMIVAVKANTFKIHELIQDPEIRQKSYLYDPYVQD 399
            |  |::             :.||   .:|..:|.::.|
  Fly   399 SVLPLV-------------LLDP---TQSATFDNFMSD 420

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11893NP_651375.1 EcKinase 52..335 CDD:281023 73/304 (24%)
CG6830NP_650103.1 EcKinase 80..372 CDD:281023 73/304 (24%)
EcKinase 516..800 CDD:281023
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45459819
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2AMXB
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11012
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.