DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11893 and CG9259

DIOPT Version :9

Sequence 1:NP_651375.1 Gene:CG11893 / 43056 FlyBaseID:FBgn0039316 Length:416 Species:Drosophila melanogaster
Sequence 2:NP_001260658.1 Gene:CG9259 / 35372 FlyBaseID:FBgn0032913 Length:422 Species:Drosophila melanogaster


Alignment Length:306 Identity:72/306 - (23%)
Similarity:121/306 - (39%) Gaps:43/306 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    48 PASAQGDHYASVMFRTTAEYTTSKGKFCKPLIIKTMPEQEGHKKDMLSDSHLFSTEINAYTKALP 112
            ||...|.|   :....|.:...|:.........|:.|.....:.:.|.|..:|..||..|...||
  Fly    45 PAGYLGSH---LYLHVTLKLHNSEEVRQLTFFSKSAPVGNESRMEYLEDFGVFEKEIAVYQNVLP 106

  Fly   113 EFERILREAGDDTKLFVPCIYHSLEPRQVLIFEDLVPQGYFV--IRDRPINMNEYKNVFSKLAKW 175
            :..:...|.       .|..|::  .:.:||||:|..|||.:  .||..:...:.......||..
  Fly   107 DLHKACAEV-------APKCYYA--DKNLLIFENLADQGYRMGAGRDGLLTYEQLHCCLKTLAAM 162

  Fly   176 HAVSM--------KVLNEQPDILKDFKYGLMEMPSIMSDPMVTTGMDNF----LKMMDQIPELTK 228
            ||.|:        |:...||..:.:..|     ||.:|...:.  |.||    |.:.:.|..:.|
  Fly   163 HAGSIIQEQRTGQKIAQSQPKSVVENAY-----PSDVSPEHMR--MVNFQNACLVLKEFIKLIPK 220

  Fly   229 YKPHFEKIKENYIQRMGDVMQEYRKNVQSDGYY-VMCHGDFHGRNMMFNKNE------EVMFVDF 286
            |:...:.:.||:.::|..:.:..:   .||.|. .:.|||....|:||....      :...|||
  Fly   221 YQSKLDYVLENFTEKMSFIFEAVK---TSDVYQNTILHGDLWANNIMFQYGRYGEVPLQCRLVDF 282

  Fly   287 QICNLCPITIDLSYSVYMLMEPEQRWDLGKDLINFYFSVLEDTLKK 332
            |:....|..:|:...:.:....|.|.....:|:..|:..:.:.||:
  Fly   283 QLARYAPPVLDVLTVLTIPTSKEFRDAHLSELLAEYYRFMTEFLKR 328

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11893NP_651375.1 EcKinase 52..335 CDD:281023 70/302 (23%)
CG9259NP_001260658.1 PKc_like 57..328 CDD:304357 67/289 (23%)
APH <252..325 CDD:279908 16/72 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45459893
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2AMXB
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11012
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.