DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11893 and F59B1.10

DIOPT Version :9

Sequence 1:NP_651375.1 Gene:CG11893 / 43056 FlyBaseID:FBgn0039316 Length:416 Species:Drosophila melanogaster
Sequence 2:NP_872223.1 Gene:F59B1.10 / 353438 WormBaseID:WBGene00019101 Length:428 Species:Caenorhabditis elegans


Alignment Length:375 Identity:71/375 - (18%)
Similarity:125/375 - (33%) Gaps:120/375 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    42 TDLKITPAS-----AQGDHYASVMFRTTAEYTTSKGKFCKPLIIKTMP---EQEGHKKDMLSDSH 98
            |:.::|..|     ..|:.::|.:...:..:|.......|.||:|.:.   .|....|....::.
 Worm    35 TESELTAESKMEVIGDGNGFSSRVLLISCNWTIPSAHLPKKLILKIVSFVHIQALIDKGKQQNAS 99

  Fly    99 LFSTEINAYTKALPEFERILREAGDDTKLFVPCIYHSLEPRQVLIFEDLVPQGYFVIRDRPINMN 163
            |.:.|:.....|.  ||...::..:....|.. :......:.:||     |:.||..:....|.|
 Worm   100 LITKEVEEQMYAY--FESSCKKMHNQEMNFYE-VAGKFNSKTLLI-----PKVYFYTKLDEKNSN 156

  Fly   164 ------------------------EYKNVFSKLAKWHAVSMKVLNEQPDILKDFKYGLMEMPSIM 204
                                    |.:.:...:||..|:|   |....:|.||.:          
 Worm   157 KGFIGMEYVEGSIVRHSYDTCTIEEIQPILRAIAKLQALS---LQNPAEISKDLQ---------- 208

  Fly   205 SDPMVTTG--MDNFLKMMDQIPELTKYKPHFEKIKENYIQRMG---DVMQEYRKNV--------- 255
               .:..|  ....||||  :.| :..|..||:.:.....|.|   |.::|.|..:         
 Worm   209 ---KIDNGAIFQETLKMM--LSE-SGIKGIFEQCRNLERSRFGEKVDRIEEKRNEILDFEKAFNL 267

  Fly   256 -------QSDGYYVMCHGDFHGRNMMFNKNEEVM----FVDFQICNLCPITIDLSYSVYMLMEPE 309
                   |:    |:||||....|.::.:|..|.    .||:|:.:|                  
 Worm   268 NKVVGIKQN----VLCHGDLWAANFLWTENNGVFCATRIVDYQMSHL------------------ 310

  Fly   310 QRWDLGKDLINFYFSVLEDTLKKVGYKGKMPTNDGLWKQIHRHKFYDFFL 359
              .:..:||:....|.:....::..           |:|| ..:||.:||
 Worm   311 --GNPAEDLVRLLVSTITGADRQAH-----------WQQI-LEQFYSYFL 346

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11893NP_651375.1 EcKinase 52..335 CDD:281023 61/334 (18%)
F59B1.10NP_872223.1 DUF1679 8..422 CDD:369592 71/375 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2AMXB
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.