DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11893 and CG33509

DIOPT Version :9

Sequence 1:NP_651375.1 Gene:CG11893 / 43056 FlyBaseID:FBgn0039316 Length:416 Species:Drosophila melanogaster
Sequence 2:NP_001014494.1 Gene:CG33509 / 3346225 FlyBaseID:FBgn0053509 Length:389 Species:Drosophila melanogaster


Alignment Length:334 Identity:77/334 - (23%)
Similarity:138/334 - (41%) Gaps:41/334 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    53 GDHYASVMFRTTAEYTTSKGKFCK--PLIIKTMPEQEGHKKDMLSDSHLFSTEINAYTKALPEFE 115
            ||:||     .|..|...:.:..:  .|.:|.||:|...    ||...:|..|...|...:.:.:
  Fly    39 GDYYA-----LTLRYCHEEEEIIREIELFVKAMPQQSAE----LSKESIFQKESWLYDTLIKKLQ 94

  Fly   116 RILREAGDDTKLFVPCIYHSLEPRQVLIFEDLVPQGYFVIRDRPINMNEYKNVFSKLAKWHAVSM 180
            .:     .:.|....|:|   ..:.:::.|::..:|:.......:|....|.:...:|.:|:.|:
  Fly    95 AL-----SNVKWSPNCVY---SRKDLMVLENIKLKGFTSAGSAELNEVFVKPLIKSIAAFHSASL 151

  Fly   181 KVLNEQPDILKDFKYG--LMEMPSIMSDPMVTTGMDNFLKMMDQIPELTKYKPHFEKIKENYI-- 241
             |...|........||  |:|:.........|||:...|.:   :..|.||:.:.|   :::|  
  Fly   152 -VYEHQTKTNIGHTYGDNLLEITVDSEIAWFTTGLSAVLAV---VRSLAKYQGNRE---QSFIGD 209

  Fly   242 QRMGDVMQEYRKNVQSDGY-YVMCHGDFHGRNMMF--NKNEEVMFVDFQICNLCPITIDLSYSVY 303
            :.||.:...|.:...|..| .|:||.|....|:.|  ..:...:.:|||.|...|...||::.:|
  Fly   210 KLMGIMETIYEQAAPSKKYRNVLCHRDIWAGNIFFPPENSGPALLIDFQTCRYAPPASDLNFCLY 274

  Fly   304 MLMEPEQRWDLGKDLINFYFSVLEDTLKKVGYKGKMPTNDGLWKQIHRHKFYDFFLLTTFSPMIV 368
            |.:...:|..:.|..|:.|.:.|...|..:|.:..:.:...|.:.      |:.|.|  |..:..
  Fly   275 MNLSSSKRKQMEKQGIDLYHTYLLQNLSDLGLEELVISKSELLES------YEEFRL--FGVVYR 331

  Fly   369 AVKANTFKI 377
            ||.|...|:
  Fly   332 AVAATVVKV 340

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11893NP_651375.1 EcKinase 52..335 CDD:281023 67/290 (23%)
CG33509NP_001014494.1 PKc_like 63..305 CDD:304357 60/260 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45459872
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2AMXB
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11012
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.