DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11893 and CG33510

DIOPT Version :9

Sequence 1:NP_651375.1 Gene:CG11893 / 43056 FlyBaseID:FBgn0039316 Length:416 Species:Drosophila melanogaster
Sequence 2:NP_001014493.2 Gene:CG33510 / 3346224 FlyBaseID:FBgn0053510 Length:426 Species:Drosophila melanogaster


Alignment Length:421 Identity:87/421 - (20%)
Similarity:150/421 - (35%) Gaps:110/421 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 LRTYEKCPEL------------EVTDLKITPASAQ----GDH---YASVMFRTTAEYTTSKGKFC 75
            |.|.|:|.::            .:.:..|.||:..    |::   |.........:..||:    
  Fly    18 LFTLEECNKILANLLADKNEQGVLLNFNIVPATEHTGFLGEYFHLYFQYQLEDQKDVQTSR---- 78

  Fly    76 KPLIIKTMPEQEGHKKDMLSDSHLFSTEINAY--TKALPEFERILREAGDDTKLFVPCIYHSLEP 138
              |.:|::..|..:.:..:....|...||..|  ...|.:|.:.:..|        .|.:   ..
  Fly    79 --LFVKSVIFQNANMEFYMEKMGLIEKEIKLYDLLNELKKFSKHVWSA--------KCYF---TR 130

  Fly   139 RQVLIFEDLVPQGYFVI--RDRPINMNEYKNVFSKLAKWHAVSMKVLNEQ-PDILKDFKYGLMEM 200
            :.:.:.:::...||..:  ..|.:|.|:...:...||..||.|:....:| ..|..:|:..|.| 
  Fly   131 KDLFVMQNVEDMGYVALPPGTRFLNENQMGPILKSLATLHASSIAYEKQQGKTIGVEFRKWLKE- 194

  Fly   201 PSIMSDPMV---TTGMDNFL-------KMMDQIPELTKYKPHFEKIKENYIQRMGDVMQEYRKNV 255
              :..||.|   |||:...|       .::|. ||..:|                 :.||..:.:
  Fly   195 --VSVDPEVEWYTTGLRAVLAVAAIHPDVLDN-PEAQEY-----------------IAQELPRCL 239

  Fly   256 QSDGYY-----------VMCHGDFHGRNMMFNK----NEEVMFVDFQICNLCPITIDLSYSVYML 305
              |..|           |..|.|....|:.::|    .|..:.||||:|...|..:|.....|:.
  Fly   240 --DKVYCMVNPSPVHRNVFVHRDAWNANVFYHKEKPHEERSILVDFQLCRYSPPAMDFHLVTYLN 302

  Fly   306 MEPEQRWDLGKDLINFYFSVLEDTLKKVGYKGKMPTNDGLWKQIHRHKFYDFFLLTTFSPMIVAV 370
            :||..|..:...||..|:..|.:..:::|..   |..:.|.||.......||.|   |......:
  Fly   303 LEPFSRKKMIGSLIETYYDALAEEFREMGVN---PYQEQLSKQEFEQSLNDFSL---FGATYNCI 361

  Fly   371 KANTFKIHELIQDPEIRQKSYLYDPYVQDVK 401
            .|...:               |.|.|::::|
  Fly   362 AATVLR---------------LPDNYLKNLK 377

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11893NP_651375.1 EcKinase 52..335 CDD:281023 66/319 (21%)
CG33510NP_001014493.2 CHK 134..329 CDD:214734 51/217 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45459879
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2AMXB
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11012
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.