DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11893 and CG33511

DIOPT Version :9

Sequence 1:NP_651375.1 Gene:CG11893 / 43056 FlyBaseID:FBgn0039316 Length:416 Species:Drosophila melanogaster
Sequence 2:NP_001014492.2 Gene:CG33511 / 3346223 FlyBaseID:FBgn0053511 Length:415 Species:Drosophila melanogaster


Alignment Length:386 Identity:91/386 - (23%)
Similarity:167/386 - (43%) Gaps:63/386 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    53 GDHYASVMFRTTAEYTTSKGKFCKPLIIKTMPEQEGHKKDMLSDSHLFSTEINAYTKALPEFERI 117
            |::|   .....||....|.|:.....||::|.:...:::......:|..|...|::.||:.::.
  Fly    44 GEYY---KLHLEAEVKGDKKKYFLNYFIKSLPRKNEPQREECERKGVFQKESALYSQILPKIQKY 105

  Fly   118 LREAGDDTKLFVPCIYHSLEPRQVLIFEDLVPQGYFVIR-DRPINMNEYKNVFSKLAKWHAVSMK 181
            ..:     ||:..|.|   ....:|:.|||. |.|..:| :....::.||.|...|::.||.|:.
  Fly   106 ATK-----KLYPKCYY---SRNDILVLEDLT-QDYRHLRANEYYTLDHYKIVLEHLSELHAASIA 161

  Fly   182 -VLNEQPDILKDFKYGLMEMPSIMSDPMVTTGMDNFLKMMDQIPELTKYKPHFEKIK-ENYIQ-R 243
             ...|...|.:.:|..|:|:....::....||       :..|..|....|||:.:| :|:|| :
  Fly   162 WEEKENVKIYESYKNVLIELHLDSNNSWYITG-------LKAIVFLAARNPHFQTMKAQNFIQDK 219

  Fly   244 MGDVMQEYR------KNVQSDGYYVMCHGDFHGRNMM--FNKNEEVM-----FVDFQICNLCPIT 295
            :.:::.:..      |.:::    |:||.|....|::  |||...|:     .||||:...|..|
  Fly   220 LYNLLTKAEELVAPSKTIRN----VLCHRDTWDHNIVYYFNKESSVLPNACCIVDFQLTQYCSPT 280

  Fly   296 IDLSYSVYMLMEPEQRWDLGKDLINFYFSVLEDTLKKVGYKGKMPTNDGLWKQIHRHKFYDFFL- 359
            :|:.:.:|::...|.|..:..:.:..|:..|:..|.::|....:.|.:...|:..|.:.....: 
  Fly   281 LDVLFLLYIVASAEVRRAIYDECLEHYYKNLQHHLDRLGLDKNLITENNFRKECQRTRLAALVIW 345

  Fly   360 -----LTTFSPMIVAVKANTFKIHELIQDPEIRQKSYLYDPYVQ-DVKKLLGKYEEM--GY 412
                 .|..||.|    :|..:..|    ||      .:|.|:. |..:||.:..|:  ||
  Fly   346 ALTEPQTKMSPSI----SNRLRSEE----PE------KFDYYLNCDRSELLLRVIEIQPGY 392

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11893NP_651375.1 EcKinase 52..335 CDD:281023 71/298 (24%)
CG33511NP_001014492.2 PKc_like 41..319 CDD:304357 71/297 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45459886
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11012
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.