DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11893 and CG31288

DIOPT Version :9

Sequence 1:NP_651375.1 Gene:CG11893 / 43056 FlyBaseID:FBgn0039316 Length:416 Species:Drosophila melanogaster
Sequence 2:NP_733094.1 Gene:CG31288 / 318664 FlyBaseID:FBgn0051288 Length:428 Species:Drosophila melanogaster


Alignment Length:418 Identity:111/418 - (26%)
Similarity:176/418 - (42%) Gaps:62/418 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MPENADTEQFNADELEAPAWLNAQFITDVLRTYEKCPELEVTDLKITPASA--QGDHYASVMFRT 63
            |.:|.|....| :.|..|.|:|.::...||...|  |: .|..||.|..:|  .|:::.|.|.|.
  Fly     1 MSDNDDIVNPN-EHLIIPDWINEKYFESVLAKDE--PD-HVKVLKFTVVAAIPPGENFTSTMLRV 61

  Fly    64 TAEYTTSKGKF-CKPLIIKTM-PEQEGHKKDMLSDSHLFSTEINAYTKALPEFERILREAGDDTK 126
            ..:.....|.. .|..|.||| ||:.|...  :::..||..|...|...||.||.:.::.|.|.:
  Fly    62 YIKLEMKDGSVKTKTYIFKTMLPEERGGSD--INEFGLFPKEAMMYKTYLPAFEALYKDVGWDIQ 124

  Fly   127 LFVPCIYHSLEPRQ---VLIFEDL-VPQGYFVIRDRPINMNEYKNVFSKLAKWHAVSMKVLNE-- 185
            |...|::  .|.|:   ..||||| |.:...:.|.:.::|........|||::||.| .|..|  
  Fly   125 LAPKCLH--TEEREGDIHFIFEDLCVKRFKNMDRTKGLDMEHMTKCLQKLAEYHAAS-AVYEELH 186

  Fly   186 ------------QPDILKDFKYGLMEMPSIMSDPMVTTGMDNFLKMMDQIPELTKYKPHFEKIKE 238
                        :.|:.|....|...........|::.|    ||..|      ||...|..:|:
  Fly   187 GPYPSEFSEGFVKKDVKKFHVDGFQLKEKAYKKAMLSWG----LKDAD------KYIKAFPTVKQ 241

  Fly   239 NYIQRMGDVMQEYRKNVQSDGYYVMCHGDFHGRNMMFN-----KNEEVMFVDFQICNLCPITIDL 298
            .:.|.:..:      .:..|.::|:.||||...|:|.:     ..|:::.:||||.......:||
  Fly   242 YWAQCLSTL------ELNPDEFHVLNHGDFWSSNLMSSYLPDGTLEKLILIDFQIVMWGSPAMDL 300

  Fly   299 SYSVYMLMEPEQRWDLG-KDLINF---YFSVLEDTLKKVGYKGKMPTNDGLWKQIH--RHKFYDF 357
            .:  ::.:.|..  ||. |:..:|   |:..|.:.||.:..|..:|....|...::  .|.||.|
  Fly   301 LF--FLTLSPTN--DLRIKEFDHFVRIYWERLVECLKVLKLKKPLPKLRDLQNSMNNKNHSFYAF 361

  Fly   358 FLLTTFSPMIVAVKANTFKIHELIQDPE 385
            |.:....|:|:........||.|..:.|
  Fly   362 FSILNHLPIILFPTDKDSNIHNLSANTE 389

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11893NP_651375.1 EcKinase 52..335 CDD:281023 80/311 (26%)
CG31288NP_733094.1 EcKinase 50..331 CDD:281023 78/305 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45459728
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2AMXB
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25766
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11012
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.850

Return to query results.
Submit another query.