DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11893 and CG2004

DIOPT Version :9

Sequence 1:NP_651375.1 Gene:CG11893 / 43056 FlyBaseID:FBgn0039316 Length:416 Species:Drosophila melanogaster
Sequence 2:NP_001259353.1 Gene:CG2004 / 31809 FlyBaseID:FBgn0030060 Length:425 Species:Drosophila melanogaster


Alignment Length:344 Identity:78/344 - (22%)
Similarity:131/344 - (38%) Gaps:86/344 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    42 TDLKITPASAQGDHYASVMFRTT------AEYTTSKGKFCKPLIIKTMPEQEGHKKDMLSDSHLF 100
            |..|..|:..:||.|.|.:||.|      ||....:.:....:|:|.||:.. |::.:......|
  Fly    32 TSYKFGPSGKKGDAYLSRVFRITIYGVKEAEEGQDEKQLEISVIVKAMPDNL-HRRRLFRSVIFF 95

  Fly   101 STEINAYTKALP------------------EFERILREAGDDTKLFVPCIYHSLEPRQVLIFEDL 147
            ..|||.|||.||                  |:.|.|....|....|:             ..||:
  Fly    96 RNEINFYTKVLPAIEAFQKSRQPAPKKPFVEYPRCLASLCDGVNDFI-------------ALEDV 147

  Fly   148 VPQGYFV-IRDRPINMNEYKNVFSKLAKWHAVSM-------KVLNEQPDILKDFKYG-------- 196
            .|:||.. :|...|::.:.......|.::|.|::       |...:....|::..||        
  Fly   148 GPRGYRAPVRQDYISLEDALLTMRTLGRFHGVALAFNALDSKNFEKAAGSLEETYYGEHTREWYT 212

  Fly   197 --LMEMPSIMSDPMVTTGMDNFLKMMDQIPELTKYKPHFEKIKENYIQ--RMGDVMQEYRKNVQS 257
              |:...::.:|            .:.||...:||    |.:..|::|  ...|::     |:.|
  Fly   213 GFLLLAENVATD------------AVKQIYPNSKY----ETVATNFLQPPLFDDLI-----NLVS 256

  Fly   258 --DGYYVMCHGDFHGRNMMFNKN-----EEVMFVDFQICNLCPITIDLSYSVYMLMEPEQRWDLG 315
              ....|..|||....|.:...|     ||::.:|||:.....:.:|||:.:|.....|.|....
  Fly   257 TRSKLSVFGHGDCWTPNFLTKYNERGQSEEIIIIDFQLARCSSLALDLSFFIYSCTSQELREQHY 321

  Fly   316 KDLINFYFSVLEDTLKKVG 334
            .:|:..|....:|.::.:|
  Fly   322 DELLRAYLESAQDLIQDLG 340

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11893NP_651375.1 EcKinase 52..335 CDD:281023 75/334 (22%)
CG2004NP_001259353.1 EcKinase 42..340 CDD:281023 74/332 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11012
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.