DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11893 and CG32195

DIOPT Version :9

Sequence 1:NP_651375.1 Gene:CG11893 / 43056 FlyBaseID:FBgn0039316 Length:416 Species:Drosophila melanogaster
Sequence 2:NP_001262006.1 Gene:CG32195 / 317907 FlyBaseID:FBgn0052195 Length:401 Species:Drosophila melanogaster


Alignment Length:413 Identity:102/413 - (24%)
Similarity:192/413 - (46%) Gaps:46/413 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 NAQFITDVLRTYEKCPELEVTDLKITPASAQGDHYASVMFRTTAEYTTSKGKFCKPLIIKTMPE- 85
            :|::....|.....|..|.|.:..|...|.:|:::.||::|..             |:.:..|: 
  Fly     7 SAEYFERALARAYGCEMLRVENFHIKAVSQKGENFCSVIYRVA-------------LVFRRSPDG 58

  Fly    86 -QEGHK---KDML-SDSHLFSTEINAYTKALPEFERILREAGDDT---KLFVPCIYHSLEP-RQV 141
             .|..|   ||:| :.:.|.:.|.:.:...||..:.||.||..:.   ||...|:...:.. :::
  Fly    59 ALESGKYILKDLLPAAAALGTNEKDMFEVLLPAMQAILEEAPKEIGEHKLSADCLLVEISAGKEL 123

  Fly   142 LIFEDLVPQGYFVI-RDRPINMNEYKNVFSKLAKWHAVSMKVLNEQPDILK-----DFKYGLMEM 200
            .|.|||...||... |.:.:|:.|.|....|||::|..|..:..::|::::     .:..||.:.
  Fly   124 YILEDLGALGYESFDRRQGLNLEEAKICVRKLAQFHGASKVLYEKKPELIQRLSPSHYANGLNDR 188

  Fly   201 PSIMSDPMVTTGMDNFLK-MMDQIPELTKYKPHFEKIKENYIQRMGDVMQEYRKNVQSDGYYVMC 264
               .:..:|..|.:...: ..:::||::|...  .:|.:.|.:||.||:...:.::.:     :.
  Fly   189 ---FAQALVLEGAEYAAEAFAEELPEISKKMK--AQIPKAYTKRMRDVVDPNKSSLNA-----VI 243

  Fly   265 HGDFHGRNMMFN-KNEEVMFVDFQICNLCPITIDLSYSVYMLMEPEQRWDLGKDLINFYFSVLED 328
            |||....|:||: .|::...||||.|......|||.:..|..::||...:...:|:|:||..|.:
  Fly   244 HGDPWLNNIMFDFVNKKATLVDFQNCYWGSPAIDLYFLFYTSLKPELLLNNQDELLNYYFDNLLE 308

  Fly   329 TLKKVGYKGKMPTNDGLWKQIHRHKFYDFFLLTTFSPMIVAVKANT--FKIHELIQ-DPEIRQKS 390
            ||:..|||..:||...|..::.|..||.::.:....|:..|....:  |.:|..:. |..::::.
  Fly   309 TLRHCGYKDTLPTFGQLKDEMKRCLFYGYYTVVCELPICCASPEASVDFGVHTFVDTDAMLKKRH 373

  Fly   391 YLY--DPYVQDVKKLLGKYEEMG 411
            .|:  :...|.:|..|..::..|
  Fly   374 QLFASERVRQTIKATLLMFDREG 396

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11893NP_651375.1 EcKinase 52..335 CDD:281023 76/300 (25%)
CG32195NP_001262006.1 EcKinase 37..315 CDD:281023 76/300 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45459581
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2AMXB
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25766
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11012
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.850

Return to query results.
Submit another query.