DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11893 and T16G1.3

DIOPT Version :9

Sequence 1:NP_651375.1 Gene:CG11893 / 43056 FlyBaseID:FBgn0039316 Length:416 Species:Drosophila melanogaster
Sequence 2:NP_506237.2 Gene:T16G1.3 / 188553 WormBaseID:WBGene00011797 Length:389 Species:Caenorhabditis elegans


Alignment Length:345 Identity:69/345 - (20%)
Similarity:137/345 - (39%) Gaps:86/345 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    99 LFSTEINAYTKALPEFERILREAGDDTKLFVPCIYHSLEPRQVLIFE-DLVPQGYF--------V 154
            |.:.|:|.|        .|:.:...|..|..|.::.|.:      |: :.:.:|:|        :
 Worm    82 LHNREVNLY--------EIIGKWNMDDVLMSPKVFFSKK------FDSENLTKGFFAMEYVDNAI 132

  Fly   155 IRDRPINMNEYK--NVFSKLAKWHAVSMKVLNEQPDILKDFKYGLMEMPSIMSDPMVTTGMDNFL 217
            .|...||:..|:  ::...||.:.|.|:|:...:.:.:..:     ::..|:.......|:::..
 Worm   133 TRHLYINLKSYELHSILKSLAVFQAESLKLNKREQESVTGY-----DLEKIVGKMFSQNGLNSIF 192

  Fly   218 KMMDQI--PELTKYKP----------HFEKIK--ENYIQRMGDVMQEYRKNVQSDGYYVMCHGDF 268
            :.:.||  .||::...          :|:.:|  .||:        ..:||       |:.|||.
 Worm   193 EQVRQINKEELSEAADKIAVFGVELVNFDLVKNLNNYL--------GIKKN-------VLVHGDL 242

  Fly   269 HGRNMMFNKNEEVM----FVDFQ---ICNLCPITIDLSYSVYMLMEPEQRWD-LGKDLINFYFSV 325
            ...|:|:.:|::..    .:|:|   :.|.....:.|..|.....|.::.|: |.:....::...
 Worm   243 WSANIMWKENKDEFRVDKIIDYQSIHLGNPAEDLVRLFISTLSGSERQKYWEKLLEQFYEYFIEA 307

  Fly   326 LEDTLKKVGYKGKMPTNDGLWKQIHRHKFY--DFFLLTTFSPMIVAVKANTFKIHELIQDPEIRQ 388
            |||  |.|.|     |.:.| |:.:|..|.  ...:|..|.|:.      ..|:.|:....|:::
 Worm   308 LED--KNVPY-----TLEQL-KESYRLYFVTGSLLMLPMFGPIA------EVKLAEMSDPDEVKK 358

  Fly   389 KSYLYDPYVQDVKKLLGKYE 408
            ...:   ..:..|:||...|
 Worm   359 YREI---LTEKTKRLLNDME 375

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11893NP_651375.1 EcKinase 52..335 CDD:281023 53/268 (20%)
T16G1.3NP_506237.2 PKc_like 1..381 CDD:389743 69/345 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2AMXB
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.