DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11893 and E02C12.10

DIOPT Version :9

Sequence 1:NP_651375.1 Gene:CG11893 / 43056 FlyBaseID:FBgn0039316 Length:416 Species:Drosophila melanogaster
Sequence 2:NP_505430.3 Gene:E02C12.10 / 183989 WormBaseID:WBGene00017095 Length:417 Species:Caenorhabditis elegans


Alignment Length:206 Identity:41/206 - (19%)
Similarity:81/206 - (39%) Gaps:54/206 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   181 KVLNEQP-DILKDFK-YGLME-MPSIMSDPM------------------------------VTTG 212
            ||.:.:| |...|.| :.:|| :|::.|.||                              .:.|
 Worm   136 KVYHLKPFDDANDLKGFMIMEFIPNVHSIPMYEAIPADDLISLVRGIATFAALGETSEGDKTSAG 200

  Fly   213 MDNFLKMM-DQIPELTKYKPHFEKIK-------ENYIQRMGDVMQEYR-------KNVQSDGY-Y 261
            ...|:.|| :::..:.:.:.||:.::       .|.::....::::||       |..:..|: .
 Worm   201 GPEFIDMMFEEVLSMDQIEGHFDSLRILYGSEHLNTVETSITILRQYRMITKKYTKISELLGFKL 265

  Fly   262 VMCHGDFHGRNMM-----FNKNEEVMFVDFQICNLCPITIDLSYSVYMLMEPEQRWDLGKDLINF 321
            |:.|||....||:     |...:....:|:|..:..|..:|||..:...:...:|.:.|.:::..
 Worm   266 VLNHGDLWQSNMLHCLDEFGNLKLKAIIDWQGVSTLPPGLDLSRLLMGCLSAHERRERGLEMLKL 330

  Fly   322 YFSVLEDTLKK 332
            |.......|.|
 Worm   331 YHETFNQVLGK 341

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11893NP_651375.1 EcKinase 52..335 CDD:281023 41/206 (20%)
E02C12.10NP_505430.3 DUF1679 3..408 CDD:369592 41/206 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2AMXB
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.