DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11893 and T16G1.7

DIOPT Version :9

Sequence 1:NP_651375.1 Gene:CG11893 / 43056 FlyBaseID:FBgn0039316 Length:416 Species:Drosophila melanogaster
Sequence 2:NP_506233.1 Gene:T16G1.7 / 179774 WormBaseID:WBGene00011801 Length:436 Species:Caenorhabditis elegans


Alignment Length:289 Identity:56/289 - (19%)
Similarity:105/289 - (36%) Gaps:92/289 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    99 LFSTEINAYTKALPEFERILREAGDDTKLFVPCIYH------SLEPRQVLIFEDLVPQGYFV--- 154
            |.:.|:|.|        :|..:...:..:..|.||.      ..:.:.:|..|       ||   
 Worm   122 LHNREVNLY--------KITEKWNKNETMLSPKIYFYKKFDAENKTKGILGME-------FVSDV 171

  Fly   155 -IRDRPINMNEYK--NVFSKLAKWHAVSMKVLNEQPDILKDFKYGLMEMPSIMSDPMVTTGMDNF 216
             ||....|...|:  .|...||...|.|:.:..::.:.:..|.:..| |.::|::    .||.|.
 Worm   172 TIRHLYCNAKPYELHPVLRSLATLQAGSLHLTEDEINSISGFDFKQM-MGAMMNE----EGMKNI 231

  Fly   217 LKMMDQI-PE-LTKYKPHFEKIKENYIQRMGDVMQEYRKNVQSDGYY-----VMCHGDFHGRNMM 274
            .:...:| || ||:        |.|.::..|..:..:..:...:.|.     |:.|||....|::
 Worm   232 YEQTREINPERLTE--------KTNTVEAFGLEVVNFELSCNLNKYVGIERDVLVHGDLWAANIL 288

  Fly   275 FNKNEEVMF-----VDFQICNLCPITIDLSYSVYMLMEPEQRWDLGKDLINFYFSVLEDTLKKVG 334
            :.:..:..|     :|:|:.::                    .:..:||:..:.|.|        
 Worm   289 WKEENDGKFSVSKVIDYQLIHM--------------------GNPAEDLVRVFLSTL-------- 325

  Fly   335 YKGKMPTNDGLWKQIH----RHKFYDFFL 359
                    .|..:|.|    ..:||::||
 Worm   326 --------SGADRQAHWERLLEQFYEYFL 346

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11893NP_651375.1 EcKinase 52..335 CDD:281023 49/259 (19%)
T16G1.7NP_506233.1 DUF1679 10..423 CDD:369592 56/289 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2AMXB
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.