DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13658 and CG18765

DIOPT Version :9

Sequence 1:NP_651374.2 Gene:CG13658 / 43055 FlyBaseID:FBgn0039315 Length:422 Species:Drosophila melanogaster
Sequence 2:NP_001097750.1 Gene:CG18765 / 59149 FlyBaseID:FBgn0042110 Length:393 Species:Drosophila melanogaster


Alignment Length:343 Identity:68/343 - (19%)
Similarity:136/343 - (39%) Gaps:63/343 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   100 FKTEILMYSKALPELERILREAGDTTKLYAPCIYHSLEPHQVMIFED-LVPQGYTVIRD-RYPNK 162
            |.||..|:...||.||.:.:.:........|.|...|:...  |:.| ::.:||:|... :..:.
  Fly    92 FSTERHMFEVVLPALEELYQNSDRIVHFGPPVIQAKLKSSH--IYGDYILNKGYSVANGLKGLSV 154

  Fly   163 EELQKAFFKLAKWHAASMKVLNERPDFLKEFKYGLWGMPNFLNDSIVTTGVPCFLEMLDKVPELT 227
            ..::....|||.:||.:...:.:.|..::|       :|....:|          :..::..||.
  Fly   155 TAMEGVLSKLAAYHAGTAAYIAKTPGKIRE-------LPKLRENS----------KSDEETAELK 202

  Fly   228 KY--------------KPYFEKIK--DNYIQQMSAVMEEYRTNPKPNRYYVLCHGDFHGRNMMFR 276
            ..              :.|.:|:|  ..|::..:.:::. :|:     :.|:.:|.....|::.:
  Fly   203 SLYQLRFHESLRSNDARQYEDKVKSFQKYVKSGTEILDS-KTS-----FNVILNGSCWPNNLLLQ 261

  Fly   277 YNKETGSFEDVMLVDFQISNVCPLSIDLIYSIFMV-MDTEDRWDLGKEYINYYFSVLADTLKKIG 340
            .: ..|:.:|.:...|..:...|...||..|:... .:...|:|   .|:.:|...|.:.|..:.
  Fly   262 VD-AFGNVKDTLFSGFHTAQYGPAVYDLFSSLLTAPAEKSSRFD---GYVKFYHDQLIENLNLLK 322

  Fly   341 FKGEMPTQTGVWEHI--HGHKDYEFFMMTSFLPLVAAMNTKTFKSMDSFFDPQTKQKSFFLDEYI 403
            |.|:.|:.|.:...:  :||  :.|...|..||:|.           |.|.....::.|....:.
  Fly   323 FLGKKPSLTDLQLDLLKYGH--WAFETATEILPIVL-----------SDFGNNDIEELFRNPVFG 374

  Fly   404 TDVKMLLRKFEELGYFKD 421
            ..::.||...|..|||::
  Fly   375 EQIRELLPWMENRGYFEE 392

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13658NP_651374.2 EcKinase 52..341 CDD:281023 48/259 (19%)
CG18765NP_001097750.1 PKc_like 56..323 CDD:304357 48/259 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45459834
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2AMXB
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11012
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.