DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13658 and CG10559

DIOPT Version :9

Sequence 1:NP_651374.2 Gene:CG13658 / 43055 FlyBaseID:FBgn0039315 Length:422 Species:Drosophila melanogaster
Sequence 2:NP_651382.2 Gene:CG10559 / 43063 FlyBaseID:FBgn0039323 Length:415 Species:Drosophila melanogaster


Alignment Length:350 Identity:80/350 - (22%)
Similarity:143/350 - (40%) Gaps:43/350 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 PAWLNAELIEGALRAYEKDPELHVTDLKISPATLQGDHYASVMFRAVSHYSTAKGNFSKALIVKT 82
            |.||.|.|.|..|..........:...|.......|::|:::|.|.................:..
  Fly    11 PTWLRANLFEELLSKRYGGNYAGIKSFKPEAGLKPGENYSTIMLRLKLEVELQDHTIENVSYMLK 75

  Fly    83 MPEQEGHKKDMLSNSPIFKTEILMYSKALPELERILREAGDTTKLYAPCIYHSLEPHQVMIFEDL 147
            .|......:::|..:.:|..|..::.:.:||||::.::.|...|..|.. |....|...::.:||
  Fly    76 TPYDFEMYREILRKNNMFAVERDVFIQVIPELEQMYKDVGVEVKFGAKA-YEIDAPDDYVLLQDL 139

  Fly   148 VPQGYTVIRDRYPNKEELQK--AFFKLAKWHAASMKVLNERPDFLKEFKYGLWGMPNFLNDSIVT 210
            .|.|:..: ||....:.:..  ...|:|:|||.|...::.:..:.:          |:|..:...
  Fly   140 GPLGFRNV-DRLEGLDMVHTKCVLKKMAQWHAVSATRIHLKGPYPQ----------NYLQPTYAD 193

  Fly   211 TGVPCFLEMLDKVPE-LTKY----KPYFE----------KIKDNYIQQMSAVMEEYRTNPKPNRY 260
            |    ..|.:::|.| |.||    .|.:|          |::...:..|.|:     ..|.|..:
  Fly   194 T----MKESIEQVAETLGKYFLKCLPLYEGYEEYSAAVHKMQPKIVDLMYAM-----NTPDPQDF 249

  Fly   261 YVLCHGDFHGRNMMFRYNKETGSFEDVMLVDFQISNVCPLSIDLIYSIFMVMDTEDRWDLGK--E 323
            ..|.|||....|:||:|..|:....:...||.|:..|..::.||||  |::..|:....|.:  .
  Fly   250 NALNHGDCWTSNIMFKYEDESPEPIETYFVDLQLPKVTSVAYDLIY--FLLGSTKFEIQLSQFDY 312

  Fly   324 YINYYFSVLADTLKKIGF-KGEMPT 347
            :|.||...|.:.|:.:.: :.:.||
  Fly   313 FIKYYHDHLVEHLRMLNYPEAKTPT 337

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13658NP_651374.2 EcKinase 52..341 CDD:281023 70/307 (23%)
CG10559NP_651382.2 EcKinase 45..330 CDD:281023 70/307 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45459778
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11012
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.