DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13658 and CG10550

DIOPT Version :9

Sequence 1:NP_651374.2 Gene:CG13658 / 43055 FlyBaseID:FBgn0039315 Length:422 Species:Drosophila melanogaster
Sequence 2:NP_651380.2 Gene:CG10550 / 43061 FlyBaseID:FBgn0039321 Length:425 Species:Drosophila melanogaster


Alignment Length:435 Identity:111/435 - (25%)
Similarity:184/435 - (42%) Gaps:53/435 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 DEVDAPAWLNAELIEGALRAYEKDPELHVTDLKISP--ATLQGDHYASVMFRAVSHYSTAKGNFS 75
            :.:..|.|:|.|..:..:   |||.|.....:.:.|  ||..|::|.|:|.|.:.......|:..
  Fly    15 EHLHIPKWINEEYFQPII---EKDVENFDKIINLVPIAATAPGENYTSIMIRVIVDILLKDGSEQ 76

  Fly    76 K-ALIVKTMPEQEGHKKDMLSNSPIFKTEILMYSKALPELERILREAGDTTKLYAPCIYHSLEPH 139
            : :.|:|||.|.:. ..|::....:|..|..||...:|:..::.:|||...:|...|::......
  Fly    77 RVSYILKTMLEADS-GADVIDGMGLFPKERKMYEVHIPQFVKLYKEAGLEIELAPKCLHVDATDE 140

  Fly   140 QV-MIFEDLVPQGYTVIRDR-----YPNKEELQKAFFKLAKWHAASM--KVLNERPDFLKEFKYG 196
            .: |:||||..|.:... ||     .|:..|:.:   |||:.||||:  |.:|...|.:      
  Fly   141 LITMVFEDLSRQNFKNF-DRLKGFDLPHMREVLR---KLAELHAASVVAKEINGPYDAM------ 195

  Fly   197 LWGMPNFLNDSIVTTGVPCFLEMLDKVPE---LTKYKPYFEKIKDNYIQQMSAVMEEYRTNPKPN 258
                   .|.||.........|.|.|..|   |...:.:..:..::||.:|...:|.:....:.|
  Fly   196 -------YNMSIYNEQSRDLFESLGKQREEQFLKAMRNWDLENAESYIARMWDPLEVFEEAVQVN 253

  Fly   259 R-----YYVLCHGDFHGRNMMFRYNKETGSFEDVMLVDFQISNVCPLSIDLIYSIFMVMDTEDRW 318
            :     :.||.|||....|:||.| |:.|..:..:|||.|:......:.||.|.|......:.:.
  Fly   254 QVDEDEFNVLNHGDCWSNNIMFNY-KDNGEIDRTILVDLQVGKWGSPAQDLWYLITTSASLDIKI 317

  Fly   319 DLGKEYINYYFSVLADTLKKIGFKGEMPTQTGVWEHIHGHKDYEFF--------MMTSFLPLVAA 375
            .....:|..|...||:.||.:.:...:||...:  ||...| |.|:        |:.:.:|....
  Fly   318 KEFDHFIQIYHQRLAECLKLLNYSKPIPTLRDL--HIMMLK-YGFWGPLTAMGVMVATLMPTDKD 379

  Fly   376 MNTKTFKSMDSFFDPQTKQKSFFLDEYITDVKMLLRKFEELGYFK 420
            .|.|...:.....| ..:.::|....|...:|:||..|:..|..|
  Fly   380 ANMKMILAQGPEAD-AIRYRTFINPYYAKAMKVLLPFFDNKGLLK 423

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13658NP_651374.2 EcKinase 52..341 CDD:281023 80/305 (26%)
CG10550NP_651380.2 EcKinase 53..340 CDD:281023 80/305 (26%)
APH 108..338 CDD:279908 65/247 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45459750
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2AMXB
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25766
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11012
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.850

Return to query results.
Submit another query.