DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13658 and CG31097

DIOPT Version :9

Sequence 1:NP_651374.2 Gene:CG13658 / 43055 FlyBaseID:FBgn0039315 Length:422 Species:Drosophila melanogaster
Sequence 2:NP_733093.2 Gene:CG31097 / 43058 FlyBaseID:FBgn0051097 Length:420 Species:Drosophila melanogaster


Alignment Length:409 Identity:106/409 - (25%)
Similarity:173/409 - (42%) Gaps:44/409 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 PAWLNAELIEGALRAYEKDPELHVTDLKISPATL-QGDHYASVMFRAVSHYSTAKGNFS-KALIV 80
            |.|||....|..:.  :.:|:....|...:.|.: .|.::||||.|.........|:.. |:.:|
  Fly    13 PKWLNKSKFESLIA--KDEPDFTKIDQFTTVAAVPPGGNFASVMLRVYLDIVMKDGSQKRKSYVV 75

  Fly    81 KTMPEQEGHKKDMLSNSPIFKTEILMYSKALPELERILREAGDTTKLYAPCI-YHSLEPHQVMIF 144
            |||.|.:...| .::....|..|..|||..||:.|:|.|.||...:|...|: ...::.:...||
  Fly    76 KTMLESDKGGK-AVNEMRYFHKEQQMYSTYLPQFEKIYRVAGHPVQLMPKCLEIGEIDGNIYFIF 139

  Fly   145 EDLVPQGYTVI-RDRYPNKEELQKAFFKLAKWHAASMKVLNERPDFLKEFKYGLWGMPNFLNDSI 208
            |||..:.:... |.:..|.|.::.:..|||:.||||:........:..:|..|      |.....
  Fly   140 EDLSTRNFVAADRTKGVNMEHMRLSLRKLAELHAASVIYKERYGPYHADFDNG------FARKDK 198

  Fly   209 VTTGVPCFLEMLDKVPELTKYKPYFEK--IKDNYIQQMSAVMEEY------RTNPKPNRYYVLCH 265
            :...|..| |:  |.||   ||...:.  |.:.|::..... |:|      ..|..|..:.||.|
  Fly   199 IEHSVRRF-EV--KAPE---YKAAMKTWGIDECYLKNFPTT-EQYGKLCLESLNVDPQDFNVLTH 256

  Fly   266 GDFHGRNMMFRYNKETGSFEDVMLVDFQISNVCPLSIDLIYSIFMVMDTEDRWDLGKEYINYYFS 330
            |||...|::|:|| |.|:..:.:::||||......:.||:..|.:....:..:......:..|:.
  Fly   257 GDFSPSNILFKYN-ENGAPSEALILDFQICKWASPTQDLLMLIILSARKDSSYKEFDNIVRIYWE 320

  Fly   331 VLADTLKKIGFKGEMP----TQTGVWEHIHGHKDYEFFMMT----SFLPLVAAMNTKTFKSMDSF 387
            .|.|.|:.:.:|..:|    .|:.:::..:....: |.:|.    ..||:....|..||...|..
  Fly   321 YLIDFLRVLKYKKPLPQLRELQSAIYKKNNTFSAF-FAVMNHLPGDLLPVCKENNLHTFNLEDEV 384

  Fly   388 FDPQTKQKSFFLDEYITDV 406
                  .|||....|...:
  Fly   385 ------GKSFRTKVYTNPI 397

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13658NP_651374.2 EcKinase 52..341 CDD:281023 83/299 (28%)
CG31097NP_733093.2 EcKinase 46..331 CDD:281023 83/299 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45459736
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2AMXB
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25766
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11012
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.940

Return to query results.
Submit another query.