DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13658 and CG31098

DIOPT Version :9

Sequence 1:NP_651374.2 Gene:CG13658 / 43055 FlyBaseID:FBgn0039315 Length:422 Species:Drosophila melanogaster
Sequence 2:NP_733091.1 Gene:CG31098 / 43057 FlyBaseID:FBgn0051098 Length:417 Species:Drosophila melanogaster


Alignment Length:445 Identity:118/445 - (26%)
Similarity:202/445 - (45%) Gaps:77/445 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 APAWLNAELIEGALRAYEKDPELHVTDLKISPATLQGDH---YASVMFRA---VSHYSTAKGNFS 75
            ||.||.||.::..|:.:.|:.:|.||:|.:..|.: ||.   :||.|.||   :...:..||.||
  Fly    10 APEWLTAEFLQDVLKEHFKEEQLAVTELIVKSAQV-GDQAAGFASEMHRASFNLQRGTAPKGKFS 73

  Fly    76 KALIVKTMPEQEGHKKDMLSNSPIFKTEILMYSKALPELERILREAGDTTKLYAPCIYHSLEPHQ 140
              :|||..|  :|....:...|.:||.|||.|.:.||.::.:|:..||.||:...|.|.:..|..
  Fly    74 --VIVKDHP--KGQTGAVAHRSKLFKREILAYKEVLPRIQALLQSIGDQTKIAPTCYYTTESPEP 134

  Fly   141 VMIFEDLVPQGY-TVIRDRYPNKEELQKAFFKLAKWHAASMKVLNERPDFLKEFKYGLWGMP--- 201
            .:|.||:...|: ...|.|..|.:.:.....|:||.||.|..:..:.|:.|:.|...    |   
  Fly   135 FLILEDMQLSGFENFERGRLLNLDYVLPTIEKVAKLHACSALIAQDSPEVLEFFDEA----PISR 195

  Fly   202 -----NFLNDSIVTTGVPCFLEMLDKVPELTKYKPYFE------KIKDNYIQQMSAVMEEYRTNP 255
                 :||  :.....:.|..|      |:..:|.|.|      .:.:|.:|:...:.|   :..
  Fly   196 NPDRRDFL--TFFPVNIRCVAE------EVAHWKGYEEITEKMFNLAENVLQRALTMFE---STG 249

  Fly   256 KPNRYYVLCHGDFHGRNMMFRYNKETGSFEDVMLVDFQISNVCPLSIDLIYSIFMVMDTEDRWDL 320
            |..|.:.|.  |....|::|..|.||...:||:.:|||::.|...:|||.|.::..::...|...
  Fly   250 KDFRVFNLT--DLWINNLLFHINNETKEPDDVVTLDFQLAYVGSPTIDLNYFLYGSLNENVRKVH 312

  Fly   321 GKEYINYYFSVLADTLKKIGFKGEMPTQTGVWEHIHGHKDYEFFMMTSFLPLVAA---------- 375
            .|..:..|..||..||:|:.::|.:||...:  ||.       .:.||.:.::.|          
  Fly   313 YKYIVREYQRVLQQTLEKLNYQGHIPTLKEI--HIE-------LIKTSLMGVIGATCLTPLIFRE 368

  Fly   376 ---------MNTKTFKSMDSFFDPQTKQKSFFLDEYITDVKMLLRKFEELGYFKD 421
                     :|::| :|.|.|     ::::....:|...::..:::||..|:..:
  Fly   369 GAGFENLEDLNSRT-ESGDRF-----RRENVENPKYRAFLQRTIKEFELSGFLDE 417

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13658NP_651374.2 EcKinase 52..341 CDD:281023 88/309 (28%)
CG31098NP_733091.1 EcKinase 50..333 CDD:281023 86/303 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2AMXB
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25766
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11012
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.