DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13658 and CG14314

DIOPT Version :9

Sequence 1:NP_651374.2 Gene:CG13658 / 43055 FlyBaseID:FBgn0039315 Length:422 Species:Drosophila melanogaster
Sequence 2:NP_650690.1 Gene:CG14314 / 42179 FlyBaseID:FBgn0038581 Length:438 Species:Drosophila melanogaster


Alignment Length:392 Identity:89/392 - (22%)
Similarity:162/392 - (41%) Gaps:94/392 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 ADEVDAPAWLNAELIEGALRAYEKDPELHVTDLKISPATLQGDHYASVMFRAVSHYSTAKGNFSK 76
            |:.|::...|:.|:.:...:..|  |::.:...:::..:.:||:|.:.::|...........:.:
  Fly    17 ANAVESKQILSLEVFQDIFKHVE--PDVQIDAFELAQGSDRGDNYTAALYRIKLTGKRRSLKWEQ 79

  Fly    77 ALIVKTMPE----QEGHKKDMLSNSPIFKTEILMYSKALPELERILREAGDTTKLYAPCIYHSLE 137
            .:|.|.|||    :|.:|.|.|     |:.|:..|:..:|||   |:.....|....| :::::.
  Fly    80 NVICKVMPESVVAREAYKSDKL-----FRNEVQFYNTIMPEL---LKFQASKTNQDTP-VFNAIP 135

  Fly   138 P-----HQVMIFEDLVPQGYTVIRDRYP--NKEELQKAFFKLAKWHAASMKVLNERPDFLKEFKY 195
            .     |.::|.|||..:|:. :.||:.  :.||.|....::|:.|..|:....|:|   .||. 
  Fly   136 KCYSARHDLLIMEDLRERGFQ-MSDRHKGLSLEETQSVLLQVAQLHGLSLAYKFEKP---LEFS- 195

  Fly   196 GLWGMPNFLNDSIVTTGVPCFLEMLDKVPELTKYKPYFEKIKDNYIQQMSAVMEEYRTNPKPNRY 260
                  |..  |:::.|:.|       ....:.|:.|:|::..|.||.:|.|:       .|:..
  Fly   196 ------NLC--SMISEGIFC-------TANTSWYRNYYERLTKNAIQMVSEVL-------PPDSK 238

  Fly   261 YVL----------------------------CHGDFHGRNMMFRYNKE-TGSFEDVMLVDFQISN 296
            |||                            ||||....|.::.|:.| .....:|.|:|||:..
  Fly   239 YVLAMNKFAESSSFFGRMVKLASTESPLSAICHGDCWVNNFLYHYDPEDPHRVLEVALLDFQLIR 303

  Fly   297 VCPLSIDLIYSIFMVMDTEDR----WDLGKEYINYYFSVL----------ADTLKKIG--FKGEM 345
            ...:::|:...::.....|.|    ..|.|.|....|..|          .|||:|:.  |..|:
  Fly   304 YSSIALDIANLLYCCTTKEMRDAQLQTLLKIYTEELFRWLQMLCTNLPDHCDTLQKLQDLFAEEL 368

  Fly   346 PT 347
            .|
  Fly   369 KT 370

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13658NP_651374.2 EcKinase 52..341 CDD:281023 80/344 (23%)
CG14314NP_650690.1 EcKinase 56..346 CDD:281023 76/325 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2AMXB
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11012
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.