DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13658 and CG6908

DIOPT Version :9

Sequence 1:NP_651374.2 Gene:CG13658 / 43055 FlyBaseID:FBgn0039315 Length:422 Species:Drosophila melanogaster
Sequence 2:NP_650105.1 Gene:CG6908 / 41410 FlyBaseID:FBgn0037936 Length:449 Species:Drosophila melanogaster


Alignment Length:383 Identity:96/383 - (25%)
Similarity:183/383 - (47%) Gaps:31/383 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 PAWLNAELIEGALRAYEKD-PEL-HVTDLKISPATLQGDHYASVMFRAVSHYSTAKGN-FSKALI 79
            ||||:.:..|..|   |:| |:| .:...::.|...:|::|.:::.||........|: .|.:.:
  Fly    48 PAWLDQQKFEPIL---ERDFPDLKKIKSFRLEPTAGKGENYTTLLLRANFELELNDGSEQSISYM 109

  Fly    80 VKTMPEQEGHKKDMLSNSPIFKTEILMYSKALPELERILREAGDTTKLYAPCIYHS-LE-PHQVM 142
            .|.:| ..|:::::.| ..:|..|...|.:.:||.|::.::||.... :.|..|.| :| ..:::
  Fly   110 AKILP-NSGNRENVAS-WKVFYKERNTYGQYIPEFEQMYKDAGKKIS-FGPRYYESQIELDDELI 171

  Fly   143 IFEDLVPQGY-TVIRDRYPNKEELQKAFFKLAKWHAASMKVLNERPDFLKEFKYGLWGMPNFLND 206
            :.|||..:|: .|.|....:.:..:....|||::||||......:..:.:|:...|..:.:.|.:
  Fly   172 VLEDLGKRGFRNVDRQNGLDIQHTEATLEKLAQFHAASAVRFELKGSYPEEYNQNLCSVVDSLKE 236

  Fly   207 SIVTTGVPCFLEM--LDKVPELTKYKPYFEKIKDNYIQQMSAVME-EYRTNPKPNRYYVLCHGDF 268
             :....:..:::.  |.....||.....:....|:..|..:..:| |:|         ||.|||.
  Fly   237 -LRENQLKAYIDAFPLYDASHLTNDVQAYGSQADDMFQSFAPKIEGEFR---------VLNHGDA 291

  Fly   269 HGRNMMFRYNKETGSFEDVMLVDFQISNVCPLSIDLIYSIFMVMDTEDRWDLGK-EY-INYYFSV 331
            ...|:|::|: |.|...:|..||.|:|.....:.||:|.|  :..||....:.| :| |.:|...
  Fly   292 WCNNIMYQYD-EAGKLAEVNFVDLQMSRFSSPAQDLLYLI--LSSTELDIKIAKFDYLIKFYHEK 353

  Fly   332 LADTLKKIGFKGEMPTQTGVWEHIHGHKDYEFFMMTSFLPLVAAMNTKTFKSMDSFFD 389
            |.::||.:.:...:|:...:.:.|..:.|:...:::..|||| .::.....:|||..|
  Fly   354 LIESLKLLKYPKPLPSLRSLHQSIFIYGDWILPIVSILLPLV-LIDGGDDANMDSLMD 410

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13658NP_651374.2 EcKinase 52..341 CDD:281023 74/297 (25%)
CG6908NP_650105.1 EcKinase 81..363 CDD:281023 74/297 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45459757
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11012
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.