DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13658 and CG6834

DIOPT Version :9

Sequence 1:NP_651374.2 Gene:CG13658 / 43055 FlyBaseID:FBgn0039315 Length:422 Species:Drosophila melanogaster
Sequence 2:NP_650104.2 Gene:CG6834 / 41409 FlyBaseID:FBgn0037935 Length:895 Species:Drosophila melanogaster


Alignment Length:418 Identity:103/418 - (24%)
Similarity:184/418 - (44%) Gaps:24/418 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 PAWLNAELIEGALRAYEKDPELHVTDLKISPATLQGDHYASVMFR-AVSHYSTAKGNFSKALIVK 81
            |.|||....|..|.|: .|....:...::.||...|::||::|.| ::....|.|.......::|
  Fly    62 PEWLNQTQFEELLAAH-VDQFSKIVGFQVKPAMAPGENYATLMLRISIDVELTDKSTKLVCFMLK 125

  Fly    82 TMPEQEGHKKDMLSNSPIFKTEILMYSKALPELERILREAG-DTTKLYAPCIY---HSLEPH--Q 140
             :|......:.||:.:..|.:|..:||..||:||.:.:..| |.|  :||..:   ...||.  .
  Fly   126 -VPHNVPQMEQMLAMANFFNSENKVYSDILPKLEELYKAKGLDIT--FAPKAFKLDSVKEPKLAN 187

  Fly   141 VMIFEDLVPQGY-TVIRDRYPNKEELQKAFFKLAKWHAASMKVLNERPDFLKEFKYGLWGMPNFL 204
            .::..||...|: .:.|....|.|:.:.|..|||::||||...:.....:..:|..|:.|....:
  Fly   188 TVLMSDLSQDGFKNLNRLECLNLEQTKFALKKLAQFHAASSMNVQVNGPYEDQFVNGVMGGNKEV 252

  Fly   205 NDSIVTTGVPCFLEMLDKVPELTKYK---PYFEKIKDNYIQQMSAVMEEYRTNPKPNRYYVLCHG 266
            ..:.....|..|...|  :..|..:|   .:.||::..::|..  :..|:.....|:.:.||.||
  Fly   253 LMAFYEGMVASFRTAL--MANLKNFKNGEEFREKLEKAFVQIF--LDFEHLMTADPDEFNVLNHG 313

  Fly   267 DFHGRNMMFRYNKETGSFEDVMLVDFQISNVCPLSIDLIYSIFMVMDTEDRWDLGKEYINYYFSV 331
            |....|::|:.:.: |..:|::.||||.......:.||.|.|...:..:.:.|..:.:|.:|...
  Fly   314 DCWMNNLLFKLDSK-GEVQDMLFVDFQNPKYGSPTQDLFYLILTSVHIDYKLDYFEYFIRHYHEQ 377

  Fly   332 LADTLKKIGFKGEMPTQTGVWEHIHGHKDYEFFMMTSFLPLVA--AMNTKTFKSM--DSFFDPQT 392
            |...|..:||.|:.|:...:...::.|..:..|.....||:|.  ...:.||::.  ||....:.
  Fly   378 LTQHLDLLGFTGKQPSLRELHMLMYKHGSWAVFPSIGVLPIVLLDPNESATFENFLGDSESSAKF 442

  Fly   393 KQKSFFLDEYITDVKMLLRKFEELGYFK 420
            |...:....|...::.||...:..|:.:
  Fly   443 KNLLYTNKRYHGYIEKLLPWLDNKGFLE 470

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13658NP_651374.2 EcKinase 52..341 CDD:281023 75/299 (25%)
CG6834NP_650104.2 EcKinase 95..387 CDD:281023 75/299 (25%)
EcKinase 529..813 CDD:281023
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45459813
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2AMXB
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11012
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.