DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13658 and CG6830

DIOPT Version :9

Sequence 1:NP_651374.2 Gene:CG13658 / 43055 FlyBaseID:FBgn0039315 Length:422 Species:Drosophila melanogaster
Sequence 2:NP_650103.1 Gene:CG6830 / 41408 FlyBaseID:FBgn0037934 Length:891 Species:Drosophila melanogaster


Alignment Length:424 Identity:102/424 - (24%)
Similarity:183/424 - (43%) Gaps:41/424 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 AENVDSAQFNAD----------EVD----APAWLNAELIEGALRAYEKDPELHVTDLKISPATLQ 52
            ::....||.|.:          |||    .|.|||....|..|.| :.|....:...::.||...
  Fly    17 SKQAPKAQVNPEPPAPPNKPEPEVDHSDLVPKWLNQTQFEELLAA-DVDQFSKIVGFRVKPAMAP 80

  Fly    53 GDHYASVMFR-AVSHYSTAKGNFSKALIVKTMPEQEGHKKDMLSNSPIFKTEILMYSKALPELER 116
            |::||::|.| ::....|.|.....:.::| :|......:.|:|.:..|.:|...|::.||::|.
  Fly    81 GENYATLMLRISIDVELTDKSTKLVSFMMK-VPHDTPQMEQMMSMANFFTSENAAYTEILPKMEE 144

  Fly   117 ILREAGDTTKLYAPCIYH---SLEPH--QVMIFEDLVPQGY-TVIRDRYPNKEELQKAFFKLAKW 175
            :.:..|...| :||..:.   :.||.  ..::..||...|: .:.|....|.|:.:.|..:||::
  Fly   145 LYKAKGLDIK-FAPRAFKLDATKEPKVANTVLMHDLGQNGFKNINRLECLNLEQTKFALTRLAQF 208

  Fly   176 HAASMKVLNERPDFLKEFKYGLWG-----MPNFLNDSIVTTGVPCFLEMLDKVPELTKYKPYFEK 235
            |||...::.....:...|..|:.|     :..|: :.::.:....|:..|||.....:|:...||
  Fly   209 HAAGATMVQVHGPYPDIFVNGVMGNNKEAIIAFM-EGMLASFRTSFMANLDKFKNGEEYREKLEK 272

  Fly   236 IKDNYIQQMSAVMEEYRT--NPKPNRYYVLCHGDFHGRNMMFRYNKETGSFEDVMLVDFQISNVC 298
                   .::.:..|:..  ...||.:..|.|||....|::|:.| .:|..||::.||||.....
  Fly   273 -------ALAGLTMEFMKLGIVDPNEFNALNHGDCWMNNLLFKMN-SSGDLEDMVFVDFQNPKYG 329

  Fly   299 PLSIDLIYSIFMVMDTEDRWDLGKEYINYYFSVLADTLKKIGFKGEMPTQTGVWEHIHGHKDYEF 363
            ..::||:|.|...:..:.:......:|.:|...|...|..:||.|..|:...:...:..:..:..
  Fly   330 SPAMDLLYFIISSVQIDYKLSHFDFFIRHYQEALVKHLGILGFTGRKPSLRELHRTLIKYGGWVL 394

  Fly   364 FMMTSFLPLVAAMNTKTFKSMDSFFDPQTKQKSF 397
            |...|.||||....|:: .:.|:|........||
  Fly   395 FPTISVLPLVLLDPTQS-ATFDNFMSDSADGVSF 427

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13658NP_651374.2 EcKinase 52..341 CDD:281023 71/302 (24%)
CG6830NP_650103.1 EcKinase 80..372 CDD:281023 71/302 (24%)
EcKinase 516..800 CDD:281023
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45459820
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2AMXB
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11012
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.