DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13658 and CG13813

DIOPT Version :9

Sequence 1:NP_651374.2 Gene:CG13658 / 43055 FlyBaseID:FBgn0039315 Length:422 Species:Drosophila melanogaster
Sequence 2:NP_649195.1 Gene:CG13813 / 40218 FlyBaseID:FBgn0036956 Length:430 Species:Drosophila melanogaster


Alignment Length:360 Identity:79/360 - (21%)
Similarity:150/360 - (41%) Gaps:58/360 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    78 LIVKTMPEQEGHKKDMLSNSPIFKTEILMYSKALPELERILREAGDTTKLYAPCIY-HSLE-PHQ 140
            ::||..|..|..:..| .....:..|:.||.|..|....:..:....|  .||.:. :.|: |.:
  Fly    55 VVVKMAPRNEARRSHM-HVVDYYAREVFMYQKVFPVFRALSPDRNTFT--VAPALQANDLKAPDE 116

  Fly   141 VMIFEDLVPQGYTVIRDRYPNKEELQKAF-------FKLAKWHAASMKVLNERPDFLKEFKYGLW 198
            .:|||||...|:.      ||...:...:       ..||:.||.|..:....|   .:||.   
  Fly   117 FLIFEDLSESGFR------PNSRCIMPTYDIVVCSLKALAELHACSFILQQTDP---LQFKQ--- 169

  Fly   199 GMPNFL-NDSIVTTGVPCFLEMLDKVPELTKYKPYFEKIKDNYIQQMSAVMEE------------ 250
             :..|: .|::.|:.:........|. :|.|.:..   :|::...|::||.|.            
  Fly   170 -LVEFVEKDNLFTSDIEEVTIEFGKA-QLRKARII---LKESDGDQVAAVQEVLQLCENQLKSLA 229

  Fly   251 -YRTNPKPNR-YYVLCHGDFHGRNMMFRYNKETGSFEDVMLVDFQISNVCPLSIDLIYSIFMVMD 313
             |..:.|... :.|:|||||...|:::|:...:....:..|:|||:|...|..:|:::.:|...:
  Fly   230 LYCVDGKAQAPHAVICHGDFWNNNILYRHEPNSDQPVEAKLIDFQMSRYAPPVLDIVHYLFACTE 294

  Fly   314 TEDRWDLGKEYINYYFSVLADTLK--KIGFKGEMP--------TQTGVWEHIHGHKDYEFFMMTS 368
            ...|.:...::::.|::.:...||  .:..:|..|        .|.||:..|.|.....||:..:
  Fly   295 KRLRDEHFPDFMDAYYNTMDQKLKSCNLSLEGIYPRSVFNRQLQQYGVYGLIMGAFSLPFFISNA 359

  Fly   369 FLPLVAAMNTKTFKSMDSFFD-PQTKQKSFFLDEY 402
            ...:.....::..:|:.:..| |:.|:   .::||
  Fly   360 NEVIDIDTVSEAIQSISTSSDEPKYKE---LIEEY 391

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13658NP_651374.2 EcKinase 52..341 CDD:281023 64/288 (22%)
CG13813NP_649195.1 EcKinase 34..321 CDD:281023 64/285 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45459912
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11012
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.