DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13658 and CG5644

DIOPT Version :9

Sequence 1:NP_651374.2 Gene:CG13658 / 43055 FlyBaseID:FBgn0039315 Length:422 Species:Drosophila melanogaster
Sequence 2:NP_648274.1 Gene:CG5644 / 39029 FlyBaseID:FBgn0035948 Length:459 Species:Drosophila melanogaster


Alignment Length:488 Identity:98/488 - (20%)
Similarity:155/488 - (31%) Gaps:158/488 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 NAELIEGALRAYEKDPELHVTDLKISPATLQGDHYASVMFRAVSHYSTAK-------GNFSKALI 79
            |||.:. .|.:..|.....:..:..|..:..||:|.||:.| |:.....|       |:....:|
  Fly    35 NAEHLR-QLFSQSKLVSFSIAHIACSAGSSSGDNYMSVVKR-VTISQAGKDQDPELAGSEIVTVI 97

  Fly    80 VKTMPEQEGHKKDMLSNSPIFKTEILMYSKALPELERILREAGDTTKLYAPCIYHSLEPHQ---- 140
            ||....... ::.:......|..||..|....|     |..|....:|:..|  |..|...    
  Fly    98 VKRQIASLS-RRQLYRCEEAFSNEINAYRHLAP-----LLAAHSRHQLFPVC--HIAESQDRRDA 154

  Fly   141 -----VMIFEDLVPQGYTVIRDRYPNKE--ELQKAFFKLAKWHAASMKV-------LNERPDFLK 191
                 :::.:||...|:. ::||....|  :......|||:.||||:..       .....|.|:
  Fly   155 EGGEPIIVLQDLKAMGFR-MKDRLAGLELSDCLLVMKKLAQLHAASLAAQELESSSFAFHADHLQ 218

  Fly   192 EFKYGLWGMPNFLND---SIVTTGVPCFLEMLDKVPELTKYKPYFEKIKDNYIQQMSAVMEEYRT 253
            |..|     .:...|   :|:.|.|...||.|.            :...|:.:.....::||.||
  Fly   219 EIVY-----CDEATDFYATILDTSVQQALESLG------------DANADDCLTTPIRLLEELRT 266

  Fly   254 N-------------PKPNRYYVLCHGDFHGRNMMFRYNKETGSFEDVMLVDFQISNVCPLSIDLI 305
            |             ..||.  |:||||....|:|||...     |:|:..|.|.........|::
  Fly   267 NLFENLKHEINATAAAPNS--VICHGDLWVNNIMFRSEP-----EEVIFFDLQAMRKSSPIFDIL 324

  Fly   306 YSIFMVMDTEDRWDLGKEYINYYFSVLADTLKKIGFKGEMPTQT--------------------- 349
            :.|:    |..|..|...:.:...:..:..|.: ..:.::...|                     
  Fly   325 HFIY----TSTRRPLRDVHTDTLLAAYSQALSE-ELRHQLEDTTAAERLEELCEAFSLQRLSSDY 384

  Fly   350 ----------GVWEHIHGHKDYEFFMMTSFLPLVAAMNTKTFKSMDSFFDP-------------- 390
                      |:|                .||.|.             |||              
  Fly   385 VRQVHYGLAIGMW----------------ILPAVT-------------FDPNNLPNLDVMSEQNL 420

  Fly   391 ---QTKQKSFFLDEYITDVKMLLRKFEELGYFK 420
               :.|.......||...::.|:.:|.||||.:
  Fly   421 TGKEIKCTQMLTSEYHMRIRELVMEFYELGYLQ 453

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13658NP_651374.2 EcKinase 52..341 CDD:281023 74/329 (22%)
CG5644NP_648274.1 EcKinase 65..357 CDD:281023 74/330 (22%)
P-loop_NTPase <357..435 CDD:304359 10/106 (9%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2AMXB
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11012
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.