DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13658 and JhI-26

DIOPT Version :9

Sequence 1:NP_651374.2 Gene:CG13658 / 43055 FlyBaseID:FBgn0039315 Length:422 Species:Drosophila melanogaster
Sequence 2:NP_523761.2 Gene:JhI-26 / 36819 FlyBaseID:FBgn0028424 Length:439 Species:Drosophila melanogaster


Alignment Length:384 Identity:87/384 - (22%)
Similarity:148/384 - (38%) Gaps:85/384 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 WLNAELIEGALR--------AYEKDPELHVTDLKISPATLQGDHYASVMFRAVSHYSTAKGNFSK 76
            ||...::...||        :..|....||.|:.|...........:..:|...::......|.:
  Fly    10 WLRYTVLPSILRNGRLVDNYSESKVTTFHVGDIDIDVIGHSEAFMLTFCYRTTINFEYDGQKFQR 74

  Fly    77 ALIVKTMPEQEGHKKDMLSNSPIFKTEILMYSKALPELERILREAGDTTKLYAPCIYH-SLEPHQ 140
            .::||..|.......:.:...|:|..||..|::.|||.::.     ...|..||..|: .|..|.
  Fly    75 KMVVKKTPAMPPEMYESIQFGPLFTNEINFYTEILPEFQKF-----TDGKFAAPKYYYGELNQHS 134

  Fly   141 -VMIFEDLVPQGYTVIRDRYPNKEELQKAFFK---LAKWHAASMKVLNERP-------DFLKEFK 194
             |.|.|:...||:.|.:||.  ...||.|...   |.::|..:..:.::.|       |.|||.:
  Fly   135 AVAILENFAEQGWRVTKDRV--GLSLQHAMIAVSYLGRFHGFAYAMKHKNPEKFAQLTDNLKESR 197

  Fly   195 YGLWGMPNFLNDSIVTTGVPCFLEMLDKVPE-LTKYKPYFEKIKDNYIQQMSAVMEEY------R 252
            |.        ||:|...........:|:..: :..|:|   :|.:.::::...::.:|      |
  Fly   198 YA--------NDNIHPEWKLTMKTSIDRAAKAVATYQP---QIDEEFVKKFCFMISDYSQYGRQR 251

  Fly   253 TNPKPNRYYVLCHGDFHGRNMMFRY-NKETGSFEDVMLVDFQI----SNVCPLSIDLIYSIFM-- 310
            ..|: .....|||||:...|:.:|| :||..  :::|:.|:|.    |.:..|::.|..|||.  
  Fly   252 VAPR-EPLATLCHGDYVRNNVAYRYDDKEEP--QEIMMFDYQTLRVSSPMVDLNVFLAVSIFAEV 313

  Fly   311 ---------------------------VMDTEDRWDLGKEYIN---YYFSVLADTLKKI 339
                                       |.|...|.:|.|||:.   |..|:.|..|..:
  Fly   314 RDPNFEAIFCEYTLALHNSYREHAKEEVPDFLSRGELLKEYVRFLPYSLSISASFLMSL 372

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13658NP_651374.2 EcKinase 52..341 CDD:281023 78/344 (23%)
JhI-26NP_523761.2 EcKinase 54..330 CDD:281023 67/296 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11012
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.