DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13658 and CG9259

DIOPT Version :9

Sequence 1:NP_651374.2 Gene:CG13658 / 43055 FlyBaseID:FBgn0039315 Length:422 Species:Drosophila melanogaster
Sequence 2:NP_001260658.1 Gene:CG9259 / 35372 FlyBaseID:FBgn0032913 Length:422 Species:Drosophila melanogaster


Alignment Length:417 Identity:102/417 - (24%)
Similarity:168/417 - (40%) Gaps:86/417 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 DAPA-WLNAELIEGALRAYEKDPELHVTDLKISPATLQGDHYASVMFRAVSHYSTAKGNFSKALI 79
            |||| :|.:.|.            |||| ||:         :.|...|.::.:|           
  Fly    43 DAPAGYLGSHLY------------LHVT-LKL---------HNSEEVRQLTFFS----------- 74

  Fly    80 VKTMPEQEGHKKDMLSNSPIFKTEILMYSKALPELERILREAGDTTKLYAPCIYHSLEPHQVMIF 144
             |:.|.....:.:.|.:..:|:.||.:|...||:|.:...|.       ||..|::  ...::||
  Fly    75 -KSAPVGNESRMEYLEDFGVFEKEIAVYQNVLPDLHKACAEV-------APKCYYA--DKNLLIF 129

  Fly   145 EDLVPQGYTV--IRDRYPNKEELQKAFFKLAKWHAASM--------KVLNERPDFLKEFKYGL-- 197
            |:|..|||.:  .||.....|:|......||..||.|:        |:...:|..:.|..|..  
  Fly   130 ENLADQGYRMGAGRDGLLTYEQLHCCLKTLAAMHAGSIIQEQRTGQKIAQSQPKSVVENAYPSDV 194

  Fly   198 ----WGMPNFLNDSIVTTGVPCFLEMLDKVPELTKYKPYFEKIKDNYIQQMSAVMEEYRTNPKPN 258
                ..|.||.|..:|      ..|.:..:|   ||:...:.:.:|:.::||.:.|..:|:....
  Fly   195 SPEHMRMVNFQNACLV------LKEFIKLIP---KYQSKLDYVLENFTEKMSFIFEAVKTSDVYQ 250

  Fly   259 RYYVLCHGDFHGRNMMFRYNKETGSFEDV----MLVDFQISNVCPLSIDLIYSIFMVMDTEDRWD 319
            .  .:.|||....|:||:|    |.:.:|    .|||||::...|..:|::..:.:....|.|..
  Fly   251 N--TILHGDLWANNIMFQY----GRYGEVPLQCRLVDFQLARYAPPVLDVLTVLTIPTSKEFRDA 309

  Fly   320 LGKEYINYYFSVLADTLKK--IGFKGEMPTQTGVWEHIHGHKDYEFFMMTSFLPLVAA---MNTK 379
            ...|.:..|:..:.:.||:  :.....:|.|| .:|.:...:.........|..||..   ...|
  Fly   310 HLSELLAEYYRFMTEFLKRADLDIARFIPEQT-FYESVQKFRSVGLIESCLFCHLVILPPHCTQK 373

  Fly   380 TFKSMDSFFDPQT-KQKSFFLDEYITD 405
            ...|:|.|.|..| |:....|:.:.||
  Fly   374 LTSSVDGFNDFFTNKRIEICLEAFNTD 400

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13658NP_651374.2 EcKinase 52..341 CDD:281023 73/310 (24%)
CG9259NP_001260658.1 PKc_like 57..328 CDD:304357 76/316 (24%)
APH <252..325 CDD:279908 20/76 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45459894
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2AMXB
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11012
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.