DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13658 and F59B1.10

DIOPT Version :9

Sequence 1:NP_651374.2 Gene:CG13658 / 43055 FlyBaseID:FBgn0039315 Length:422 Species:Drosophila melanogaster
Sequence 2:NP_872223.1 Gene:F59B1.10 / 353438 WormBaseID:WBGene00019101 Length:428 Species:Caenorhabditis elegans


Alignment Length:383 Identity:75/383 - (19%)
Similarity:127/383 - (33%) Gaps:110/383 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    72 GNFSKALIVK---TMPEQEGHKKDMLSNSPIFKTEILMYSKALPELERILREAGDTTKLYAPCIY 133
            |..|:.|::.   |:|.....||.:|........:.|:..........|.:|..:....|.....
 Worm    53 GFSSRVLLISCNWTIPSAHLPKKLILKIVSFVHIQALIDKGKQQNASLITKEVEEQMYAYFESSC 117

  Fly   134 HSLEPHQVMIFED---------LVPQ--GYTVIRDRYPNK----------------------EEL 165
            ..:...::..:|.         |:|:  .||.:.::..||                      ||:
 Worm   118 KKMHNQEMNFYEVAGKFNSKTLLIPKVYFYTKLDEKNSNKGFIGMEYVEGSIVRHSYDTCTIEEI 182

  Fly   166 QKAFFKLAKWHAASMKVLNERPDFLKEFKYGLWGMPNFLNDSIVTTGV-----PC-------FLE 218
            |.....:||..|.|::...|....|::...|.. ....|...:..:|:     .|       |.|
 Worm   183 QPILRAIAKLQALSLQNPAEISKDLQKIDNGAI-FQETLKMMLSESGIKGIFEQCRNLERSRFGE 246

  Fly   219 MLDKVPELTKYKPYFEK---------IKDNYIQQMSAVMEEYRTNPKPNRYYVLCHGDFHGRNMM 274
            .:|::.|.......|||         ||.|                      ||||||....|  
 Worm   247 KVDRIEEKRNEILDFEKAFNLNKVVGIKQN----------------------VLCHGDLWAAN-- 287

  Fly   275 FRYNKETGSFEDVMLVDFQISNVCPLSIDLIYSIFMVMDTEDR---W-DLGKEYINYYFSVLAD- 334
            |.:.:..|.|....:||:|:|::...:.||:..:...:...||   | .:.:::.:|:.:.|.. 
 Worm   288 FLWTENNGVFCATRIVDYQMSHLGNPAEDLVRLLVSTITGADRQAHWQQILEQFYSYFLNELGSG 352

  Fly   335 ----TLK--KIGFKGEMPTQTGVWEHIHGHKDYEFFMMTSFLPLVAAMNTKTFKSMDS 386
                ||:  |:.||...|...                 .:.|||.........:.|||
 Worm   353 EAPYTLEQLKLSFKLYFPVGA-----------------LALLPLFGPAVDAKLEGMDS 393

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13658NP_651374.2 EcKinase 52..341 CDD:281023 66/336 (20%)
F59B1.10NP_872223.1 DUF1679 8..422 CDD:369592 75/383 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2AMXB
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.