DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13658 and CG33509

DIOPT Version :9

Sequence 1:NP_651374.2 Gene:CG13658 / 43055 FlyBaseID:FBgn0039315 Length:422 Species:Drosophila melanogaster
Sequence 2:NP_001014494.1 Gene:CG33509 / 3346225 FlyBaseID:FBgn0053509 Length:389 Species:Drosophila melanogaster


Alignment Length:393 Identity:96/393 - (24%)
Similarity:164/393 - (41%) Gaps:81/393 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 NAELIEGALRAYEKDPELHVTDLKISPATLQGDHYASVMFRAVSHYSTAKGNFSK--ALIVKTMP 84
            ||:  |.|:|....|..| |.||  |.....||:||..:     .|...:....:  .|.||.||
  Fly    13 NAQ--ESAVRVKLLDYHL-VRDL--SAIGYLGDYYALTL-----RYCHEEEEIIREIELFVKAMP 67

  Fly    85 EQEGHKKDMLSNSPIFKTEILMYSKALPELERILREAGDTTKLYAPCIYHSLEPHQVMIFEDLVP 149
            :|...    ||...||:.|..:|...:.:|:.:     ...|....|:|...:   :|:.|::..
  Fly    68 QQSAE----LSKESIFQKESWLYDTLIKKLQAL-----SNVKWSPNCVYSRKD---LMVLENIKL 120

  Fly   150 QGYTVIRDRYPNKEELQKAFFK-----LAKWHAASMKVLNERPDFLKEFKYGLWGMPNFLN---D 206
            :|:|     .....||.:.|.|     :|.:|:||: |...:........||    .|.|.   |
  Fly   121 KGFT-----SAGSAELNEVFVKPLIKSIAAFHSASL-VYEHQTKTNIGHTYG----DNLLEITVD 175

  Fly   207 SIV---TTGVPCFLEMLDKVPELTKYKPYFEKIKDNYI-QQMSAVMEEYRTNPKPNRYY--VLCH 265
            |.:   |||:...|.:   |..|.||:...|:   ::| .::..:||.......|::.|  ||||
  Fly   176 SEIAWFTTGLSAVLAV---VRSLAKYQGNREQ---SFIGDKLMGIMETIYEQAAPSKKYRNVLCH 234

  Fly   266 GDFHGRNMMFRYNKETGSFEDVMLVDFQISNVCPLSIDLIYSIFMVMDTEDRWDLGKEYINYYFS 330
            .|....|:.|. .:.:|   ..:|:|||.....|.:.||.:.::|.:.:..|..:.|:.|:.|.:
  Fly   235 RDIWAGNIFFP-PENSG---PALLIDFQTCRYAPPASDLNFCLYMNLSSSKRKQMEKQGIDLYHT 295

  Fly   331 VLADTLKKIGFKGEMPTQTGVWEHIHGHKDYEFF-------------MMTSFLPLVAAMNTKTFK 382
            .|...|..:|.:..:.:::   |.:..::::..|             :.|.|:       |..||
  Fly   296 YLLQNLSDLGLEELVISKS---ELLESYEEFRLFGVVYRAVAATVVKVPTDFI-------TNDFK 350

  Fly   383 SMD 385
            .:|
  Fly   351 YVD 353

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13658NP_651374.2 EcKinase 52..341 CDD:281023 76/304 (25%)
CG33509NP_001014494.1 PKc_like 63..305 CDD:304357 70/273 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45459873
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2AMXB
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11012
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.