DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13658 and CG33510

DIOPT Version :9

Sequence 1:NP_651374.2 Gene:CG13658 / 43055 FlyBaseID:FBgn0039315 Length:422 Species:Drosophila melanogaster
Sequence 2:NP_001014493.2 Gene:CG33510 / 3346224 FlyBaseID:FBgn0053510 Length:426 Species:Drosophila melanogaster


Alignment Length:363 Identity:73/363 - (20%)
Similarity:140/363 - (38%) Gaps:68/363 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 EKDPELHVTDLKISPATLQGDH--YASVMFRAVSHY--STAKGNFSKALIVKTMPEQEGHKKDML 94
            :|:.:..:.:..|.|||   :|  :....|.....|  ...|...:..|.||::..|..:.:..:
  Fly    34 DKNEQGVLLNFNIVPAT---EHTGFLGEYFHLYFQYQLEDQKDVQTSRLFVKSVIFQNANMEFYM 95

  Fly    95 SNSPIFKTEILMYSKALPELERILREAGDTTKLYAPCIYHSLEPHQVMIFEDLVPQGYTVI--RD 157
            ....:.:.||.:|. .|.||::..:....     |.|.:...:   :.:.:::...||..:  ..
  Fly    96 EKMGLIEKEIKLYD-LLNELKKFSKHVWS-----AKCYFTRKD---LFVMQNVEDMGYVALPPGT 151

  Fly   158 RYPNKEELQKAFFKLAKWHAASMKVLNERPDFL-KEFKYGL----------WGMPNFLNDSIVTT 211
            |:.|:.::......||..||:|:....::...: .||:..|          |          .||
  Fly   152 RFLNENQMGPILKSLATLHASSIAYEKQQGKTIGVEFRKWLKEVSVDPEVEW----------YTT 206

  Fly   212 GVPCFL-------EMLDKVPELTKYKPYFEKIKDNYIQQMSAVMEEY--RTNPKPNRYYVLCHGD 267
            |:...|       ::||. ||..:|          ..|::...:::.  ..||.|....|..|.|
  Fly   207 GLRAVLAVAAIHPDVLDN-PEAQEY----------IAQELPRCLDKVYCMVNPSPVHRNVFVHRD 260

  Fly   268 FHGRNMMFRYNKETGSFEDVMLVDFQISNVCPLSIDLIYSIFMVMDTEDRWDLGKEYINYYFSVL 332
            ....|:.  |:||....|..:|||||:....|.::|.....::.::...|..:....|..|:..|
  Fly   261 AWNANVF--YHKEKPHEERSILVDFQLCRYSPPAMDFHLVTYLNLEPFSRKKMIGSLIETYYDAL 323

  Fly   333 ADTLKKIG---FKGEMPTQTGVWEHIHGHKDYEFFMMT 367
            |:..:::|   ::.::..|    |......|:..|..|
  Fly   324 AEEFREMGVNPYQEQLSKQ----EFEQSLNDFSLFGAT 357

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13658NP_651374.2 EcKinase 52..341 CDD:281023 63/317 (20%)
CG33510NP_001014493.2 CHK 134..329 CDD:214734 46/217 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45459880
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2AMXB
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11012
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.