DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13658 and CG33511

DIOPT Version :9

Sequence 1:NP_651374.2 Gene:CG13658 / 43055 FlyBaseID:FBgn0039315 Length:422 Species:Drosophila melanogaster
Sequence 2:NP_001014492.2 Gene:CG33511 / 3346223 FlyBaseID:FBgn0053511 Length:415 Species:Drosophila melanogaster


Alignment Length:343 Identity:81/343 - (23%)
Similarity:148/343 - (43%) Gaps:55/343 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 NAELIEGALRAYEKD--------PELHVTDLKISPATLQGDHYASVMFRAVSHYSTAKGNFSKAL 78
            |..||...:.|..||        .:||:      .|.::||                |..:....
  Fly    24 NVILINSQVDAGSKDLMGYMGEYYKLHL------EAEVKGD----------------KKKYFLNY 66

  Fly    79 IVKTMPEQEGHKKDMLSNSPIFKTEILMYSKALPELERILREAGDTTKLYAPCIYHSLEPHQVMI 143
            .:|::|.:...:::......:|:.|..:||:.||::::..     |.|||..|.|   ..:.:::
  Fly    67 FIKSLPRKNEPQREECERKGVFQKESALYSQILPKIQKYA-----TKKLYPKCYY---SRNDILV 123

  Fly   144 FEDLVPQGYTVIR-DRYPNKEELQKAFFKLAKWHAASMK-VLNERPDFLKEFKYGLWGMPNFLND 206
            .|||. |.|..:| :.|...:..:.....|::.||||:. ...|.....:.:|..|..:....|:
  Fly   124 LEDLT-QDYRHLRANEYYTLDHYKIVLEHLSELHAASIAWEEKENVKIYESYKNVLIELHLDSNN 187

  Fly   207 SIVTTGVPCFLEMLDKVPELTKYKPYFEKIK-DNYIQ----QMSAVMEEYRTNPKPNRYYVLCHG 266
            |...||       |..:..|....|:|:.:| .|:||    .:....||.....|..| .||||.
  Fly   188 SWYITG-------LKAIVFLAARNPHFQTMKAQNFIQDKLYNLLTKAEELVAPSKTIR-NVLCHR 244

  Fly   267 DFHGRNMMFRYNKETGSFEDV-MLVDFQISNVCPLSIDLIYSIFMVMDTEDRWDLGKEYINYYFS 330
            |....|:::.:|||:....:. .:||||::..|..::|:::.:::|...|.|..:..|.:.:|:.
  Fly   245 DTWDHNIVYYFNKESSVLPNACCIVDFQLTQYCSPTLDVLFLLYIVASAEVRRAIYDECLEHYYK 309

  Fly   331 VLADTLKKIGFKGEMPTQ 348
            .|...|.::|....:.|:
  Fly   310 NLQHHLDRLGLDKNLITE 327

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13658NP_651374.2 EcKinase 52..341 CDD:281023 70/296 (24%)
CG33511NP_001014492.2 PKc_like 41..319 CDD:304357 73/316 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45459887
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11012
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.