DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13658 and CG5126

DIOPT Version :9

Sequence 1:NP_651374.2 Gene:CG13658 / 43055 FlyBaseID:FBgn0039315 Length:422 Species:Drosophila melanogaster
Sequence 2:NP_608584.1 Gene:CG5126 / 33306 FlyBaseID:FBgn0031320 Length:455 Species:Drosophila melanogaster


Alignment Length:422 Identity:92/422 - (21%)
Similarity:176/422 - (41%) Gaps:60/422 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    54 DHYASVMFRAVSHYSTAKGNFSKALIVKTMPEQEGHKKDMLSNSPI-FKTEILMYSKALPELERI 117
            |.:.|.::........|:...::.::||.|...|..::.  |||.| |..||..|::.||..|.:
  Fly    41 DGFMSALYTVTLDVVIAERKRTEVVLVKFMKGTEEFRES--SNSYIQFSNEIFAYAEILPAYENV 103

  Fly   118 LREA---GDTTKLYAPCIYHSLEPH---------QVMIFEDLVPQGYTVIRDRYPNKEELQKAFF 170
            ||.:   .:..|.:.||.|.:...|         .|:..:.|...||.:.......:::|:....
  Fly   104 LRTSHLESEVVKNWVPCCYFARFGHVEGLGNGRESVLALKHLKGDGYQLGPRLTLRRDQLEAMVG 168

  Fly   171 KLAKWHAA--SMKVLNERPDFLKEFKYGLWGMPNFLN-------DSIVTTGVPCFLEMLDKVPE- 225
            .:..:||.  :.|:|  :|:.....:.|:..|| |::       |.:.......|.|..|:..| 
  Fly   169 LVGPFHALGYATKIL--QPNVHARLRAGVVDMP-FVSSSGKGIFDVLYRVAFDRFYEFYDRQKEQ 230

  Fly   226 -LTKYKPYF----EKIKDNYIQQMSAVMEEYRTN----PKPNRYY-VLCHGDFHGRNMMFRYNKE 280
             |....|.|    |::::.|.:|.:.::|..||:    .:|:.:: ...|||::..|::|.|..|
  Fly   231 LLQGADPGFGAAIERLREKYFKQPTLLLERIRTSSFAEDQPDSHFATFLHGDYNRNNVLFHYGAE 295

  Fly   281 TGSFEDVMLVDFQISNVCPLSIDLIYSIFMVMDTEDRWDLGKEYINYYFSVLADTLKKI------ 339
             ...:.:..:|||.......:|||.:.::|...:|.|.::..:.:..|...:.:.|:.:      
  Fly   296 -DKVDAIKAIDFQELRFSTTAIDLSFFMYMNTPSEGRKEIYADLLRKYHRSMIEMLELVLRRNRN 359

  Fly   340 ---GFKGEMPTQTGVWEHIHGH-KDYEFF---MMTSFLPLVAAMNTKTFKSMDSFFD-----PQT 392
               ..:.:...|...:|..:.| |.|.|:   :...|||.:.. ..|....:...|:     |..
  Fly   360 ELTDDRVDQLLQEYSFERFNAHFKRYAFYGPMVCMHFLPWLLG-TEKDCAELSRLFETDMHGPAF 423

  Fly   393 KQKSFFL--DEYITDVKMLLRKFEELGYFKDL 422
            .|.|..:  ||...::...:|...|.||..::
  Fly   424 HQLSLDIAGDEANQEIFKTVRHAYEHGYMDEI 455

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13658NP_651374.2 EcKinase 52..341 CDD:281023 72/328 (22%)
CG5126NP_608584.1 EcKinase 41..353 CDD:281023 72/317 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11012
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.