DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13658 and CG31974

DIOPT Version :9

Sequence 1:NP_651374.2 Gene:CG13658 / 43055 FlyBaseID:FBgn0039315 Length:422 Species:Drosophila melanogaster
Sequence 2:NP_001259800.1 Gene:CG31974 / 33174 FlyBaseID:FBgn0051974 Length:416 Species:Drosophila melanogaster


Alignment Length:416 Identity:92/416 - (22%)
Similarity:164/416 - (39%) Gaps:92/416 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    50 TLQGDHYASVMFRAVSHYSTAKGNFSKALIVKTMPEQEGHKKDMLSNS---PIFK------TEIL 105
            |..||:|.|:|....:...:|.|......::..:|.        |:|.   .||:      ||..
  Fly    33 TKPGDNYGSIMLSVQAKIRSADGGIRDLPLIAKLPP--------LTNDLYWQIFQPERTCITENA 89

  Fly   106 MYSKALPELERILREAGD-TTKLY--APCIYHS----------LEPHQVMIFEDLVPQGYTV-IR 156
            :|....|||:::..|:|. ..:::  .|..|.|          ::...|::.|::..:||.. .|
  Fly    90 VYQYLSPELDKLQLESGILPAQIFDGFPRYYGSRVSLDNRATKVDRDAVLVQENVTTRGYRPGNR 154

  Fly   157 DRYPNKEELQKAFFKLAKWHAASMKVLNERPDFLKEFKYGLWGMPNF----LNDSIVTTGVPCFL 217
            .|..|..|.......||::||..:.:..::|...:|:.     .|.|    :|.:|.....    
  Fly   155 HRPYNLAETVLILHYLAQYHALPIALRLKKPQVYEEYV-----RPYFKKFDMNSNIDQAET---- 210

  Fly   218 EMLDKVPELTKYKPYFEKIKD-----------NYIQQMSAVMEEYR--TNPKPNRYYVLCHGDFH 269
            |:::|           |.:||           |.::::..:.:.::  .:.....:..|.|||..
  Fly   211 EIMNK-----------EILKDIKLVTSDERDVNRVKELLDIFQAFQASNDVDDGPFTTLVHGDLW 264

  Fly   270 GRNMMFRYNK--ETGSFEDVMLVDFQISNVCPLSIDLIYSIFMVMDTEDRWDLGKEYINYYFSVL 332
            ..|||.:|..  |.|:...|.:|||||:....|..|:|:.:|..:|.....|....::..|::..
  Fly   265 INNMMLKYGMRGEEGTPLKVKIVDFQIAQYGSLVHDIIFVLFSSVDVNVLEDNFYNFLTIYYNAF 329

  Fly   333 ADTLKKIGFKGEMPTQTGVWEHI----HGHKDYEFFMMTSFLPLVAAMNT---KTFKSMDSFFDP 390
            ..||:.:.......|.....|.:    |....:..|||    .::.|.|:   |.:|.:|  |..
  Fly   330 IQTLRSVNVDTSNYTYELFLEEVQQTAHVQLPHAIFMM----KVILADNSTIPKDYKDVD--FSV 388

  Fly   391 QTKQKSFFLDEYITDVKMLLRKFEEL 416
            .||.         |..|.::.|||.:
  Fly   389 LTKN---------TGAKTIVTKFEAI 405

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13658NP_651374.2 EcKinase 52..341 CDD:281023 72/330 (22%)
CG31974NP_001259800.1 EcKinase 35..337 CDD:281023 72/329 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45459654
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2AMXB
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11012
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.