DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13658 and CG7135

DIOPT Version :9

Sequence 1:NP_651374.2 Gene:CG13658 / 43055 FlyBaseID:FBgn0039315 Length:422 Species:Drosophila melanogaster
Sequence 2:NP_573269.1 Gene:CG7135 / 32793 FlyBaseID:FBgn0030895 Length:417 Species:Drosophila melanogaster


Alignment Length:430 Identity:109/430 - (25%)
Similarity:194/430 - (45%) Gaps:46/430 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 DAPAWLNAELIEGALRAYEKDPELHVTDLKISPATLQGDHYASVMFRAVSHYSTAKG-NFSKALI 79
            :.|.:|..:.....|....:..:|.|..::::..|..|::|.|.::||...|..|:. ....:||
  Fly     7 EPPLYLTPQFFRRTLEHGLQQLDLQVIGVQLTNLTRGGENYCSNIYRAQIKYRNAESCAMETSLI 71

  Fly    80 VKTMPEQEGHKKDMLSNSPIFKTEILMYSKALPELERILREAGDTTKLY--APCIYHS-LEPHQV 141
            ||:||::   |:.:|:...|:..|.|.|....|:||.::..|.|:...:  ||..|:| .:|.|.
  Fly    72 VKSMPDE---KQAILARLHIYNKETLFYMHIKPKLEALMWRAVDSFSAWTLAPKHYYSTTQPEQT 133

  Fly   142 MIFEDLVPQGYTV-IRDRYPNKEELQKAFFKLAKWHAASMKVLNERPD-FLKEFKYGLWGMPNFL 204
            :|.|||...||.: .|....:.:.......|||::||.:|.:....|: .:..:.:||..|    
  Fly   134 IILEDLCAAGYQLKCRQLGLDFDHAALVMAKLAEYHALTMVMAEREPETIVDRYPFGLLHM---- 194

  Fly   205 NDSIVTTGVP---CFLEMLDKVPEL-----------TKYKPYFEKIKDNYIQQMSAVMEEYRTNP 255
             |:|  ...|   .|...|.|:..|           ||...|.|...:..::.:         .|
  Fly   195 -DAI--NSEPFKLLFGTQLLKLAALVGDCEGFGGITTKLYRYHEHFTERVLKAV---------YP 247

  Fly   256 KPNRYYVLCHGDFHGRNMMFRYNKETGSFEDVMLVDFQISNVCPLSIDLIYSIFMVMDTEDRWDL 320
            ....:.||.|||....|:.|:|:.|. :.:.|.::|||:.....|..|:.|.:...::.|...|.
  Fly   248 LRGNHNVLNHGDLWVNNIFFKYDAEY-TVQQVKIIDFQLCFYGSLGFDINYFLNTSLELEVLRDR 311

  Fly   321 GKEYINYYFSVLADTLKKIGFKGEMPTQTGVWEHIHGHKDYEFFMMTSFLPLVAAMNTKT-FKSM 384
            .:|.::.|:..|.|.||.:.:..|:|:...:.:.|...:.|.||:...|.||::.:...: ..|:
  Fly   312 RQELVDIYYRSLVDCLKHLPWSKELPSYEDIMDEIRKREAYGFFVAFGFFPLMSMIGVDSEDNSL 376

  Fly   385 DSFFDPQ-TKQKSFFLDE----YITDVKMLLRKFEELGYF 419
            .:|.|.. .:||...:.|    .:..:|..|::.:||..|
  Fly   377 KNFHDETFARQKVQLMFEGNTRTLESLKCTLKRLDELKLF 416

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13658NP_651374.2 EcKinase 52..341 CDD:281023 83/308 (27%)
CG7135NP_573269.1 EcKinase 43..330 CDD:281023 83/306 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45459306
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2AMXB
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25766
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11012
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.850

Return to query results.
Submit another query.