DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13658 and CG1561

DIOPT Version :9

Sequence 1:NP_651374.2 Gene:CG13658 / 43055 FlyBaseID:FBgn0039315 Length:422 Species:Drosophila melanogaster
Sequence 2:NP_996412.1 Gene:CG1561 / 32108 FlyBaseID:FBgn0030317 Length:635 Species:Drosophila melanogaster


Alignment Length:340 Identity:73/340 - (21%)
Similarity:145/340 - (42%) Gaps:63/340 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 PELHVT-DLKISPATLQGDHYASVMFRAVSHYSTAKGNFSKALIVKTMPEQEGHKKDMLSNSPIF 100
            |||... :|::..|:.:||:|..|::|.     .|..:..::|:||..|:....:|...:. |.|
  Fly   241 PELGANPELRLERASAKGDNYLGVVWRL-----QAASDSKRSLVVKLPPQNRVRRKQFFAR-PCF 299

  Fly   101 KTEILMYSKALPELERILRE-----AGDTTKLYAPCI-YHSLEPHQVMIFEDLVPQGYTVIRDRY 159
            ..|...|...|| |..::::     ..|..:.:|.|. ....||::.::.|||...|:: :.:|:
  Fly   300 LRETAAYEVFLP-LTALIQDKWKIIGDDRFRQHALCFGTRQDEPNECIVLEDLSCAGFS-LHNRF 362

  Fly   160 --PNKEELQKAFFKLAKWHAASMKVLNERPDFLKEFKYGLWGMPNFLNDSIVTTGVPCFLEMLDK 222
              .:.|.:::.....||.||.|:....:.|:.:::.:.                    .:::.::
  Fly   363 LDLSVEHVRRVMLTYAKLHAISLAGKRQLPEKMQQLQQ--------------------LVDIFEQ 407

  Fly   223 VPELTKYKPYFEKIKDNYIQQMSAVMEE-YRT----------------------NPKPNRYYVLC 264
            ..:......|||.:|::.:..:.|..:: ||.                      |.:|  :.|:|
  Fly   408 RRDDHALGVYFENLKESALSALLAPADDAYRVRLEAYFARGSYFELLLPLVSGFNCEP--FAVIC 470

  Fly   265 HGDFHGRNMMFRYNKETGSFEDVMLVDFQISNVCPLSIDLIYSIFMVMDTEDRWDLGKEYINYYF 329
            |||....|:::: :.|.|..|||.|:|:|:........||.|.:|.......|....:..:..|:
  Fly   471 HGDCWNNNILYK-STERGELEDVRLIDWQLMRYASPVTDLAYFLFTCTSRRFRQRHLENMLEDYY 534

  Fly   330 SVLADTLKKIGFKGE 344
            ..|...|.::|.:.|
  Fly   535 EELGLQLIRLGERVE 549

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13658NP_651374.2 EcKinase 52..341 CDD:281023 66/319 (21%)
CG1561NP_996412.1 EcKinase 257..546 CDD:281023 66/319 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45459913
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2AMXB
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11012
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.