DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13658 and CG33301

DIOPT Version :9

Sequence 1:NP_651374.2 Gene:CG13658 / 43055 FlyBaseID:FBgn0039315 Length:422 Species:Drosophila melanogaster
Sequence 2:NP_001285793.1 Gene:CG33301 / 2768917 FlyBaseID:FBgn0053301 Length:407 Species:Drosophila melanogaster


Alignment Length:430 Identity:127/430 - (29%)
Similarity:193/430 - (44%) Gaps:65/430 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 PAWLNAELIEGALRAYEKDPELHVTDLKISPATLQGDHYASVMFRAVSHYSTAKGN-FSKALIVK 81
            |.||.|..::..||||.:|..|.|..:...|||.:|:::..||.|....|....|: .:|..|||
  Fly     3 PTWLTAAYLQPRLRAYCQDDRLQVLRIWAKPATGKGENFVGVMTRIYVDYQLGDGSVVNKTYIVK 67

  Fly    82 TMPEQEGHKKDMLSNSPIFKTEILMYSKALPELERILREAGDTTKLYAPCIYHSLEPHQVMIFED 146
            .....|..:.::.....::..|:.||...||:|:.:|:|||...||.|..|....| :..||.||
  Fly    68 QALSAEVPQAEVFFEYELYTREMDMYEFILPKLKELLQEAGLDQKLTADAITVDRE-YNTMILED 131

  Fly   147 LVPQGYTVIRDRYPNKEELQKAFFK-----LAKWHAASMKVLNER-PDFLKEFKYGLWGMPNFLN 205
            |.|..: |..||.   ::|..|..:     |||:||||: ||.|| |:.|.:..|..:    |..
  Fly   132 LAPYKF-VNADRV---KQLDMAHTELTLEMLAKFHAASI-VLQERHPNLLTKCFYTHF----FSR 187

  Fly   206 D----SIVTTGV-PCFLEMLDKVPELTK-YKPYFEKIKDNYIQQMSAVMEEYRTNPKPNRYYVLC 264
            |    |:|..|: ..||..:|..|.|.: |.....|::.:.::..:...:...::.|     .|.
  Fly   188 DKKAYSVVFAGLFKAFLRFIDGQPNLKEAYGDKLHKLRTHIMEYGARAYDVGESDLK-----TLN 247

  Fly   265 HGDFHGRNMMFRYNKETGSFEDVMLVDFQISNVCPLSIDLIYSIFMVMDTEDRWDLGKEYINYYF 329
            |||....|:||:|: :.|....|:.:|||.||....:|||.| .|.....|:..|...|.:.:::
  Fly   248 HGDCWTTNIMFQYD-DAGEPRSVVAIDFQFSNCTSPTIDLHY-FFTTSLREEVGDKESELVEHHY 310

  Fly   330 SVLADTLKKIGFKGEMPTQTGVWEHIHGHKDYEF-FMMTSFLPLVAAM-----------NTKTFK 382
            ..|...|:|..:||.:||.          ::|.. |....|:.|:|.|           .|..|.
  Fly   311 KALKANLEKFSYKGSLPTL----------QEYRLQFERRRFMSLLAHMFKPCMIYNGSEETSDFS 365

  Fly   383 SMDSFFDPQ--TKQKSFFLDE----------YITDVKMLL 410
            |:.: ..|:  ..|||.:..|          .|.|.|.||
  Fly   366 SLYA-ESPEGLRYQKSVYASEAVIRSATKLLAILDAKGLL 404

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13658NP_651374.2 EcKinase 52..341 CDD:281023 90/301 (30%)
CG33301NP_001285793.1 EcKinase 37..322 CDD:281023 90/301 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45459540
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2AMXB
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25766
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11012
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.850

Return to query results.
Submit another query.