DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13658 and T16G1.6

DIOPT Version :9

Sequence 1:NP_651374.2 Gene:CG13658 / 43055 FlyBaseID:FBgn0039315 Length:422 Species:Drosophila melanogaster
Sequence 2:NP_506234.2 Gene:T16G1.6 / 188554 WormBaseID:WBGene00011800 Length:431 Species:Caenorhabditis elegans


Alignment Length:445 Identity:89/445 - (20%)
Similarity:151/445 - (33%) Gaps:150/445 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    71 KGNFSKALIVKTMPEQ------------EGHKKDMLSNSPIFKTEILMYSKALPELERILREAGD 123
            :|.|...:.||.:.|.            |..|..::.:...|.:.::     |.|.|..:.| ..
 Worm    13 EGLFQTHVYVKDVQEAIGEQMNTESRLGENTKYTVVGDGNGFMSRVV-----LVEPEWTITE-NH 71

  Fly   124 TTKLYAPCIYHSLEPHQVMIFEDLVPQGYTVIRDRYPNKEEL--------------QKAFFKLA- 173
            ..|.:...|..||..|.::   |.:.:....|.:   |:|||              :..|:.|| 
 Worm    72 LPKKFILKICSSLHVHGIV---DKMKESNQSINE---NEEELWAMFENEAQHLHNREVNFYVLAE 130

  Fly   174 KWHAASMKVLNERPDFLKEFK-----YGLWGMPNFLNDSIVTTGVPCFLEMLDKVP--------- 224
            ||:... ::||.:..|.|:|.     .|..||...  |.:....:.|.|:..:..|         
 Worm   131 KWNKPE-ELLNAKIFFSKKFDSENKLKGFLGMEYV--DDVTIRHLYCNLKPYELHPVLKAVAQLQ 192

  Fly   225 ---------ELTKYKPYFEK-----------IKDNYIQQ-------------------MSAVMEE 250
                     ||.....:..|           :|.||.|.                   |..|..|
 Worm   193 AESLHLSDEELQSISGFDFKQMMGTMFNDDGLKGNYKQTRDINPERLKEKTDIVEAFGMEVVNFE 257

  Fly   251 YRTNPKPNRYY-----VLCHGDFHGRNMMFRYNKETGSFEDVMLVDFQISNVCPLSIDLIYSIFM 310
            :..|  .|:..     ||.|||....|::  :|:..|.|....::|:||.::...:.||:.....
 Worm   258 FAGN--LNKVVGIHKDVLVHGDLWAANIL--WNENDGKFSASKVIDYQIIHMGNPAEDLVRVFLC 318

  Fly   311 VMDTEDR---WD-LGKEYINYYFSVLAD-----TLKKIGFKGEMPTQTGVWEHIHGHKDYEFFMM 366
            .:...||   |: |.:::..|:...|.|     ||.::                  .:.|..:.:
 Worm   319 TLSGADRQAHWEKLLEQFYEYFLEALEDNEIPYTLDQL------------------KESYRLYFV 365

  Fly   367 TS---FLPLVAAM-NTKTFKSMDSFFDPQTKQKSFFLDEYITDVK-MLLRKFEEL 416
            |.   .|||...: .||...|.|:              |::.:.: :|..|.|:|
 Worm   366 TGSLVMLPLYGPIAQTKLSYSKDT--------------EHVEEYREILTEKAEKL 406

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13658NP_651374.2 EcKinase 52..341 CDD:281023 75/363 (21%)
T16G1.6NP_506234.2 DUF1679 8..417 CDD:369592 89/445 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2AMXB
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.