DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13658 and H37A05.2

DIOPT Version :9

Sequence 1:NP_651374.2 Gene:CG13658 / 43055 FlyBaseID:FBgn0039315 Length:422 Species:Drosophila melanogaster
Sequence 2:NP_506379.1 Gene:H37A05.2 / 186806 WormBaseID:WBGene00010426 Length:419 Species:Caenorhabditis elegans


Alignment Length:399 Identity:81/399 - (20%)
Similarity:152/399 - (38%) Gaps:83/399 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    54 DHYASVMFRAVSHYSTAKGNFSKALIVKTMPEQEGHKKDM------LSNSPIFKTEILMYSK-AL 111
            |..|..|...:|.|     |||..:..:|...::  .|.|      |.|..:....|:|..| |.
 Worm    74 DRIAVKMSSELSLY-----NFSTLVSSETWDIEK--MKSMTSLVKELHNREVDMYRIIMREKPAC 131

  Fly   112 PELERILREAGDTTKLYAPCIYHSLEPHQVMIFEDLVPQGYTVIRDRYPNKEELQKAFFKLAKWH 176
            |.:..:..||           :..|.|.:..|..:.:|..:.|..:...:.||:......:|.:.
 Worm   132 PTVNVLSLEA-----------FTELSPLKAYIISEYIPNLHHVGMNDCISIEEIWAVVDGIAAFS 185

  Fly   177 A--ASMKVLNERPDFLKEF------KYGLWGMPNFLNDS---------IVTTGVPCFLEMLDKVP 224
            |  .||....::...:.|.      ||       |.:|.         |:..|| .:.|.:::..
 Worm   186 AMGESMSEDEKKKSTIGEIYIEEAVKY-------FFDDQSPDNMRKNLIMILGV-AYEEKVEEAM 242

  Fly   225 ELTKYKPYFEKIKDNYIQQMSAVMEEYRTNPKPNRYYVLCHGDFHGRNMMFRYNKETGSFEDVML 289
            ::........:|:.|| .::||.:..   :|      ||.|.|....|::|..:.| ...|...|
 Worm   243 DIFDLYCGSSEIQKNY-SRVSAFLGH---SP------VLMHSDIWPSNLLFSLSSE-NKLEFKAL 296

  Fly   290 VDFQISNVCPLSIDLIYSIFMVMDTEDRWDLGKEYINYYFSVLADTLK---KIGFKGEMPTQTGV 351
            :|||.:::....:|:.......:..:||..:..|.::.|:.....:||   .|.:..|....:  
 Worm   297 IDFQTASLSSPGLDVGCLTVTCLSKKDRRTVQSEILDRYYKSFVKSLKTPNSIPYTREQLEDS-- 359

  Fly   352 WEHIHGHKDYEFFMMTS---FLPLVAAMNTKTFKSMDSFFDPQTKQKSFFLDEYITDVKMLLRKF 413
                     ||.....|   .||.:.:.:.|..::::   :...::.:..:::.:|.....|.||
 Worm   360 ---------YELCFPASVILMLPFILSFSVKLGENIN---EESVEKMAGLIEDLVTVHNSNLSKF 412

  Fly   414 EELGYFKDL 422
            .  |:||:|
 Worm   413 P--GFFKNL 419

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13658NP_651374.2 EcKinase 52..341 CDD:281023 66/313 (21%)
H37A05.2NP_506379.1 DUF1679 3..409 CDD:369592 74/385 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.