DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13658 and H06H21.8

DIOPT Version :9

Sequence 1:NP_651374.2 Gene:CG13658 / 43055 FlyBaseID:FBgn0039315 Length:422 Species:Drosophila melanogaster
Sequence 2:NP_001023255.1 Gene:H06H21.8 / 186700 WormBaseID:WBGene00019164 Length:388 Species:Caenorhabditis elegans


Alignment Length:350 Identity:62/350 - (17%)
Similarity:116/350 - (33%) Gaps:137/350 - (39%)


- Green bases have known domain annotations that are detailed below.


  Fly    76 KALIVKTMPEQEG-HKK-----DMLSNSPIFKTEILMYSKALPELERILREAGDTTKLYAPCIYH 134
            :.|:..:.||.|. |:|     :.|.|:..|.:||.:..         |:..||..|:       
 Worm     9 RRLVESSFPEIENFHEKVDASFEKLENAKSFWSEIYVAH---------LKVVGDGVKV------- 57

  Fly   135 SLEPHQVMIFEDLVPQGYTVIRDR------------YPNKEELQKAFFKLAKWHAASMKVLNERP 187
               |..|.|....:.:......|.            |..||.|                      
 Worm    58 ---PESVFIKVPRISENVLRCEDESAVNHLNDVLLYYSKKENL---------------------- 97

  Fly   188 DFLKEFKYGLWGMPNF------LNDSI---VTTGVPC--------------------FLEMLDKV 223
             |.|.|:||  .:|||      ..:.|   .|.|:..                    .|.:::.:
 Worm    98 -FYKHFEYG--SIPNFPFPKVYFTEDINGEATGGIVAENLSEKVFAVEHIPGLKHEQILRLMEAL 159

  Fly   224 PELTKY------KPYFEKI------KDNYIQQMSAVM-EEYRT--NPKPNRY------------- 260
            ..|..:      |.|.|..      ::.:.:.|..:| ||..|  |..|..:             
 Worm   160 AGLHSFLMKRDDKSYVESFVEGAHGRETFSEGMQNMMFEEALTLENVSPEVFGNDRIRNIKWSFD 224

  Fly   261 Y----------------VLCHGDFHGRNMMFRYNKETGSFEDVMLVDFQISNVCPLSIDLIYSIF 309
            |                ::||.|.:..|::::  |::...|...::|:|:..:..::.|:|..:.
 Worm   225 YSIKNKATADAISAFPGIICHADLNVTNVLWK--KDSAKDEISAIIDYQMLFIGSIAFDIIRVLT 287

  Fly   310 MVMDTEDRWDLGKEYINYYFSVLAD 334
            :.::.|.|..:.:.|:::|...|.:
 Worm   288 LGLNREIRRKMTQNYLDHYHKTLTE 312

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13658NP_651374.2 EcKinase 52..341 CDD:281023 62/349 (18%)
H06H21.8NP_001023255.1 CHK 129..312 CDD:214734 28/184 (15%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 52 1.000 Domainoid score I7662
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 53 1.000 Inparanoid score I4083
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.960

Return to query results.
Submit another query.