DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13658 and C29F7.2

DIOPT Version :9

Sequence 1:NP_651374.2 Gene:CG13658 / 43055 FlyBaseID:FBgn0039315 Length:422 Species:Drosophila melanogaster
Sequence 2:NP_510235.2 Gene:C29F7.2 / 181463 WormBaseID:WBGene00007811 Length:394 Species:Caenorhabditis elegans


Alignment Length:435 Identity:96/435 - (22%)
Similarity:169/435 - (38%) Gaps:102/435 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 WLNAELIEGALRAYEKDPELHVTDLKISPATLQGDHYASVMFRAVSHYST----AKGNFSKALIV 80
            || ||:||..:..   .|::..:.: :..:.|   .|.|::.:...|:..    :..|..|.:::
 Worm    15 WL-AEIIEKKIGV---KPKIGTSGI-LDNSEL---GYMSMIRKVQLHFDAEHEESHPNLPKHVVL 71

  Fly    81 KTMPEQEG------HKKDMLSNSPIFKTEILM------YSKALPELERILREAGDTTK-LYAPCI 132
            |.....:|      ...||.........|:.|      |.|...:|         |.| |:.|.|
 Worm    72 KIACSSKGTGVLDSAGADMTETDHSANVELFMHNTECNYYKIFAKL---------TEKPLHLPVI 127

  Fly   133 YHSLE--------PHQVM-IFEDLVPQGYTVIRDRYPNKEELQKAFFKLAKWHAASMKVLNERPD 188
            |.:::        |..|| :|||.  :.|.:|...  |:|:|.|...::.|.|..|:..      
 Worm   128 YAAIKAEDKEAPVPVIVMEMFEDC--KVYDIITGF--NEEQLYKIVDEIVKLHIFSLTT------ 182

  Fly   189 FLKEFKYGLWGMPNFLNDSIVTTGVPCFLEMLDKVPELTKYKPYFEKIKDNYIQQMSAVMEEYRT 253
              :|:|       ..:.|:.|......|..|:..:.|....:|..|.: ..||:      ..:.|
 Worm   183 --EEWK-------TIVPDAFVLEMAGYFQTMVAGIGEKLAQQPGLELV-STYIK------NTFAT 231

  Fly   254 NPK-----------PNRYYVLCHGDFHGRNMMFRYNKETGSFEDVMLVDFQISNVCPLSIDLIYS 307
            :||           ..|..||.|||.....:::..|.:...     ::|:||::......|..:.
 Worm   232 DPKFLQNINDEYLEERRISVLTHGDLWAPQILWDKNDDIAG-----IIDWQITHRGSPMEDFHHI 291

  Fly   308 IFMVMDTEDRWDLGKEYINYYFSVLADTLKKIGFKGEMPTQTGVWEHIHGHKDYEF-FMMTSFLP 371
            :......|:|.:|.|..::|||..|:..|:..|.|  ||     |......::|:: |:..:.|.
 Worm   292 MSTCTSVENRKNLTKPLLDYYFDKLSSGLEAKGVK--MP-----WTREEIEEEYKYSFINGAALT 349

  Fly   372 LVAA---MNTKTFKSMDSFFDPQTKQKSF-----FLDEYITDVKM 408
            :.|.   .|:...:: |...||....:||     :|:|.|.:..|
 Worm   350 IFANGFWANSPVLQT-DGKPDPVRIGESFKRCKSYLEEVIQEHNM 393

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13658NP_651374.2 EcKinase 52..341 CDD:281023 69/325 (21%)
C29F7.2NP_510235.2 CHK 142..321 CDD:214734 47/209 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2AMXB
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.